SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra038920 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra038920
Domain Number 1 Region: 77-207
Classification Level Classification E-value
Superfamily TPR-like 4.91e-26
Family Tetratricopeptide repeat (TPR) 0.00034
Further Details:      
 
Weak hits

Sequence:  Bra038920
Domain Number - Region: 10-97
Classification Level Classification E-value
Superfamily Antivirulence factor 0.0314
Family Antivirulence factor 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra038920
Sequence length 723
Sequence
MARSPNKHGRDQPQDFQGFLNDLQDWELSLKDKDKKMKQQPSTSSNLSSEKFRPSGSGKY
DVVKKYASSDDDSQFDANSEKEQGNEYFKQKKFNEAIDCYSRSIALSPNSVAFSNRAMAY
LKIKRLVLYPFFFLVASLPYREAEVDCTEALNLDDRYIKAYSRRATARKQLGMIKEAKED
AEFALRLEPESQELKKQYSDIKSLLEKEIIERATGAMQRTAQEMLKTAGLEKKTELTDTE
MKLKPVTIGEDMVRPSKESSGKKLIGSVQSEEKNEKGSKKVPAITETEDSKKVTSRIQSY
EMAAKSSNVNGTQSSGPGNRVTSRKLELTPSVQELAAHAASLAMAEVSKNIQAPKSAYEF
ENSWRNFSGDPALQNQLLKVTKPSSLPQIFKNALTSPVLFDIIKCVASFFNEDMDLAVKY
IYNLTKVPRFDMIVMCLTSTEKNELRKIWEDVFCNKATPMEYAEVLDELRSRYCLKQWKV
ATLEMQMNVNQGKLKSENRDMILQSLLLEIDLLLKPDMCGMNSNASKAEWIEIHKCIIGG
HHEEIQSTKVSKMHKLTSLFLPGLFSVIWLQKFELMFLYLCGETHLRYSQISPYYLDSVR
SWEFEANVTSDPEPERRKKGRKISPVALRRSKSKIPRGSDQTEPSETRYPLHDQPGTGNR
NRDRFQNRPIKKAEGMALSTWLDISHLSVTRPKLIKCFEADGPIWEPKFAPSTSVKLGKL
GKP
Download sequence
Identical sequences M4FCV1
Bra038920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]