SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra039262 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra039262
Domain Number 1 Region: 140-318
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra039262
Sequence length 437
Sequence
MTTFSRSKSTGATGFTDSKPTRPGPHMYENIHGDKYKEDHSPTSIDYYDVSTPLSSHGSR
SGSGQFTMLDLLAAVLRKSLVMSCAMERGGDDMAASMDIGWPTEVKHVSHVTFDRFNGFL
GLPSELEPEVPPRAPSASVSVFGVSAKSMQCSYDNRGNSVPTILLRMQKRLYTEGGLKAE
GIFRINPDNAKEEYVRKQLNGGVVPRGIDVHCLAGLIKAWFRELPTGVLDVLTPEQVMKC
NTEEDCSRLVTLLPPVESALLDWAIGLMADVVEYEQFNKMNARNVAMVFAPNMTQMADPL
TALIHAVQVMNFLKTLILMNLKERENAYAKSRGIDKQTSDPSEEWESHDSEILGPKKSSN
NPKFLRVSTLCRLEADNEEEFWNTEKRHDHNDTAETIGTVQRLSKLSKSTKKPLESNKDE
GRRGREAWGSRLSSLPW
Download sequence
Identical sequences A0A078IFV9 M4FDU1
Bra039262 XP_009142439.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]