SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra039316 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra039316
Domain Number 1 Region: 3-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000245
Family Synaptotagmin-like (S variant) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra039316
Sequence length 205
Sequence
MSYSRSKRSLEIELISAEGLKVNGKPVKRQTFGVVRIDQETHHKCKVDEQGGSYPIWKDR
IKTEMAVDGSVRFISVEVFYLTSGGAKKSVGVAKIPVTDFMGGFTPQGHLNFLSYRLRDE
YGDKSGIVNVSIMVKPDVNDVKYVSPSPLMVPSLGYTACSSQAAKAVNGQMWRPMTSSSM
ATTIGYGGRVVTGVPVNWPTYQRRL
Download sequence
Identical sequences M4FDZ5
Bra039316 XP_009142364.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]