SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra039549 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra039549
Domain Number - Region: 127-311
Classification Level Classification E-value
Superfamily TPR-like 0.000582
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number - Region: 11-109
Classification Level Classification E-value
Superfamily TPR-like 0.00112
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Domain Number - Region: 254-325,360-379
Classification Level Classification E-value
Superfamily TPR-like 0.00197
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra039549
Sequence length 493
Sequence
MINEMVSRGIPPDVCTYNTLISRLCKDNKLSEAIDVYGSMIDKGPEPNLQTYNSLLDGLF
TGCRLIDATKLFESMRHEEIELNVVTYNIMISGYCKYGKLEEAFELIREMNCKGLKADSY
TCMSLIRFVNKAGDSEVAKEVIDVICKSDCSLNLHHYTALIDGLIKREKIDEARRLFDQI
LPNVVAYNSMIMGYFKYGKMMEAMELITRMRRDGMRPSGAISTTLIRGARQAGNWDIALE
IFDADGHALNVIQFNALINGLIKSGRWDDAKRLFDEISDKGLVPDPITYNTMISGYCKHG
KLEEATELIRRMKHEGMEPDSYTYTSLIHASCRAGNSDAAQDIFNAIRKSGQSPDIFQFN
ALISGLIKNGKLDDAKRLFDEIQNMGLVADVVTYNIVINALCKHEMLSEARALFYELESK
GCSPDSVMFNTVITGFLQLNKVKDAVPLLESMLDRKFTPDSGVKHRLHRVLARADGRKAL
QPLLDTYGENIFE
Download sequence
Identical sequences M4FEM7
Bra039549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]