SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra039627 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra039627
Domain Number 1 Region: 495-677
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 8.5e-67
Family Inorganic pyrophosphatase 0.00000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra039627
Sequence length 682
Sequence
MSHPPPYTLVLSDKKKPACSSPKRTLTMKIKRLNTQQTTNRISIAPRTSSNGHLDDGTII
DMEDMLQYHEINFDSVIEIIDETTNYVAGVIPTLDDVTGTNLDVIVKITDFNPKAWSRID
LDVYTIDLRKNRRDSIPSEENDICAICHNELGASGDLNTLENRLIFSGTVPPIEGYSRRH
HSHETEIGYQSLCLRGFVVQASLDSRNRLLEDAFRVIDSIWWCYMVLHVNPFCPRVVREF
ISNTPFYEDGALIRGICVPFLSRVWTERKKRKTIGRVVDVHPSVGDRYYLRVLINKIHGP
RSYDELKTYNDVKYPDFKSVCHVRGYLDNDVEWLESMSEGARTATPYQLRDMFVTFLNNC
FVASPKGLWEHSWKSMSEDILQRRQRILGHANLELDDKTLEQYTLIEVEKLMRMQDRSLN
DIKDMPKINPVLLKELGNSLWNQEMDYDVSEETLRHDKHEHFEMADNKDGVTPKSSAAFP
LRNPNVTLNERNFAAFTNRSAAAHPWHDLEIGPEAPAVFNCVVEISKGGKVKYELDKNSG
LIKVDRVLYSSIVYPHNYGFIPRTICEDSDPIDVLVLMQEPVLTGSFLRARAIGLMPMID
QGEKDDKIIAVCADDPEFRHYRDIKELPPHRLAEIRRFFEDYKKNENKKVAVEGFLPAQA
AIDAIKDSMDLYAAYIKAGLQR
Download sequence
Identical sequences M4FEV5
Bra039627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]