SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra039808 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra039808
Domain Number 1 Region: 31-213
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.26e-69
Family Inorganic pyrophosphatase 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra039808
Sequence length 217
Sequence
MAPPIEIATTKNYAEKQASVPPLNERILSSLTHRSVAAHPWHDLEIGPEAPVIFNCVVEI
GKGSKVKYELDKTTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVIMQEPVIPG
CFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKN
ENKEVAVNDFLPATAAYEAVQHSMDLYADYVMETLRR
Download sequence
Identical sequences M4FFD5
Bra039808 XP_009139385.1.100322 XP_013746552.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]