SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra040212 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra040212
Domain Number 1 Region: 166-388
Classification Level Classification E-value
Superfamily TPR-like 0.0000127
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra040212
Sequence length 502
Sequence
MSRLIQNRVRNTFSRLKPSIALSSSTLTNNLSTSPEPSPEPLDESSEIWNVIIGRAGGDR
VVSEDEVFHRLSNDPFCNRVNLSDTLLNKLLHRFRDDWRSALGVLKWAESRKAHKNHSAE
AYDTAVDILGKAKKWDRMKAFVEKMKVDNTVTLNTVAKIMRRFAGAGEWEEAVNVFDRLN
EFGLEKNTESMNLLLDTLCKEKRVERARSVLLELKAHIKPDAHTFNIFINGWCKTNRVEE
ALWTIQEMRGYGFRPCVISYTTIIKCYCLKSDFIKVYEMLSEMEANDSPPNSVTYTTIMS
CLNAQKEFEESLRVAARMKRSGCEGDTLFYNCLIHTLARAGRLEEAERVFRDEMPSVNTS
TYNSMIAMYCHHDEEEKAVELLREMESLKVCEPDVHTYHPLLRSCFKRGDVVEVGRLLKE
MVTKHHLSLDESTYTFLIQRFCRADMCEWAYCLFEEMISQDIAPRHRTCLLLLDEVRKKS
MHEAVERIEYVMRSVKLTAPVK
Download sequence
Identical sequences A0A078IHB4 M4FGI4
XP_009124016.1.100322 Bra040212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]