SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra040380 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra040380
Domain Number 1 Region: 28-192
Classification Level Classification E-value
Superfamily L domain-like 3.91e-29
Family Polygalacturonase inhibiting protein PGIP 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra040380
Sequence length 235
Sequence
MVAKLVCAIFFRSCLRVLLVSSLNYSFETDINCLKSLKSQLQDPKAHLSNWIFGNYSEGY
ICKFFGVECWGSEQNRVLSINLGGYGLKGEFPSGVTLCTSMESLNLTGNNLYGTIPSEFF
SFIPYLVTLDLSHNNFASNIPASLSNMYYLKTLLLDHNWFTGHLPSGLGSSPRLQQFSVS
HNDLDGPVPDFYSMAIIAASISTAAFFPVGASVGWFYVGKTQKQPSKKRSKILTR
Download sequence
Identical sequences M4FH02
Bra040380 XP_009124570.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]