SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra040479 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra040479
Domain Number 1 Region: 31-212
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.01e-69
Family Inorganic pyrophosphatase 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra040479
Sequence length 216
Sequence
MSEETYEETMETSQSPRPAPKLNERILSTLSRRSVAAHPWHDLEIGPEAPLVFNVVVEIT
KGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGC
FLRARAIGLMPMIDQGEMDDKIIAVCADDPEYKHFTDIKQLAPHRLSEIRRFFEDYKKNE
HKEVAVNDFLPSEKAHEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences A0A078IF82 M4FHA1
Bra040479 XP_009142458.1.100322 XP_009142459.1.100322 XP_013688175.1.73403 XP_013690942.1.73403 XP_018481594.1.40639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]