SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra040883 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra040883
Domain Number - Region: 90-124,195-304,446-540
Classification Level Classification E-value
Superfamily TPR-like 0.0569
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra040883
Sequence length 575
Sequence
MAVKAQKTLILLANLIKVPPLKAFSLLNSSNLHGVQHTHESFSVLLHLLLSGNLLPHAQS
LLLQAITRRIHSQSFTPSSLLRYLTQSETSKPNSRLYEVIINAYIQSQSLDSALSYFNEM
IDKGLVPGSNCFNNLLTFVSGSSSFDEFWAFFNENKGRVVLDVYSFGIAIKACCESGEIH
KSFHLLGELRANGFSPNVVIYTTLIDGCCKKGEIEKAKALFFEMETIGLVANERTYTVLI
HGLFKNGLTKQGFETYEKMKEDGVLPNLYTYNCVMNQLCKDGRTKDAFKVFDEMRERGVS
CNVVTYNTLIGGLCREMNASEAGRLMEQMKSDGINPNLITYNTLIDGFCNAGKLGKALSL
CRDLKSRGMSMSVVTYNILVSGFCKKGDTSGAAKIVKEMEERGIKPSKVTYTILIDTFAR
SDNMERAIQLRTSMESLGLVPDVHTYSVLIHGFCIKGQMNEASRLFRSMVEKKVEPNEVI
YNTMILGYCREGSSYRALRLLTEMGDRELAPNVASYSYLVDVLCKEKKMKEAEDLVEKMI
GSGMDPSASVCNMISSAKNGSLVAQTIDKSCLNVT
Download sequence
Identical sequences M4FIF4
Bra040883 XP_009124386.1.100322 XP_013718554.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]