SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra000639 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra000639
Domain Number 1 Region: 402-776
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.45e-118
Family Oxysterol-binding protein 0.00061
Further Details:      
 
Domain Number 2 Region: 80-117,155-213
Classification Level Classification E-value
Superfamily PH domain-like 6.4e-20
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra000639
Sequence length 783
Sequence
MLSFCCVSTVSDHSLPMPLPEQPGVTRSEPIMTRSASHSQSYNHHRHQSNRHPLHSLSFN
HQSQPPPVDVKINDIVGNGIAGILHKWVNYGRGWRSRWFVLQDGVLSYYKIHGPDKIFLS
PESEKGSKVIGEESARMISSHHHNKHGASHLHRKPFGEVHLKVSSVRESRSDDKRFSIFT
GTKRLHLRADTREDRATWVEALQAVKDMFPRMSNSELMAPTNNLAMSTEKLRQRLIDEGV
SELAIQDCEQIMRSEFSALQSQLVLLKQKQWLLIDTLRQLETEKVDLENTLVDESQRQAV
NGGSIDLRHEKCSEGTATESDDDHERGDAETDEEDNTFFDTRDFLSSSSFKSSGSDFRTS
SFSSDGDGVGSSEDDIDPSIKSIGCDYPHVKRRKSLPEPVEKEKSVSLWSMIKDNIGKDL
TKVCLPVYFNEPLSSLQKCFEDLEYSYLLDRAFEWGKRGNSLMRILNVAAFAVSGYASTE
GRICKPFNPLLGETYEADYPDKGLRFFSEKVSHHPMVVACHCDGTGWKFWADSNLKSKFW
GRSIQLDPVGVLTLQFDDGEILQWSKVTTSIYNLILGKLYCDHYGTMRIEGSAEYSCKLK
FKEQSIIDRNPHQVHGIVQDKSGKTVATMFGKWDESMHYVTGDCSGKGKLSEDMSGAQLL
WKRSKPPGNPTKYNLTRFAMTLNELTPGLKEKLPPTDSRLRPDQRYLENGEFEMANEEKL
RLEQRQRQARKMQERGWKPKWFTKEEGSEAYRYKGGYWEARESGSWEDCPDIFGHIDSEQ
QTE
Download sequence
Identical sequences M4C8W1
XP_009134083.1.100322 Bra000639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]