SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra000774 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra000774
Domain Number 1 Region: 319-687
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.11e-116
Family Oxysterol-binding protein 0.00048
Further Details:      
 
Domain Number 2 Region: 31-62,100-155
Classification Level Classification E-value
Superfamily PH domain-like 2.47e-16
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra000774
Sequence length 694
Sequence
MPLTRSKSLPSTDAMAENGGSDRQNLSSGRSVAGILHKWTNYGKGWRSRWFLLRDGILSY
SKIRRPENVKMLSPSDDVRLIGDNSTDRLSRMYSCSGRGRRKHHKTIGIVHLKVSSYRES
KSDNKKFYIFTANKTLHLRTDSRSDRAAWLQALASTRRILPLQSISGDFSFVSPKDLSIS
TERLKKRLRENGINESLVKECEEIVDSEFSEVQEQIKLLHEERTKLLDALKQLEMANLEA
EASGIHESVYQLPNHNYSSLRSGKYSECSTSASSDVFEDISEEDEPSFHDTIECFSEPDA
GSENMHFKRRTRLPDPAEKEKGVSLWSMIKDNVGKDLSRVCLPVYFNEPISSLQKCFEDL
EYSYLLDQAYEYGKSGNSLLRALYVAAFAVSGYASTEGRHCKPFNPLLGETYEADFPEKG
IRFFSEKVSHHPTVIACHCEGKGWKFWGDTNLRSKFWGRSIQLEPVGVLTLEFDDGETFQ
WSKVTTTIYNILLGKLYCDHHGTMQIRGNRQYSSTLKFKEQSILDRNPHQVNGFVEDVTG
KKAATVFGKWNDSLHYVSGDAFNKASASLLWKSTKPPPNVTRYNLTSFAITLNELTPGLE
EKLPPTDSRLRPDQRHLEKGEYEKANEEKQRLERRQRMSRKIQESGWRPRWFEPQGESES
YKYTGGYWEARNERRWDDCPNIFGEFTEEIADCA
Download sequence
Identical sequences M4C995
XP_009134271.1.100322 Bra000774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]