SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra000869 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra000869
Domain Number 1 Region: 2933-3222
Classification Level Classification E-value
Superfamily BEACH domain 8.76e-123
Family BEACH domain 0.0000000266
Further Details:      
 
Domain Number 2 Region: 3276-3556
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.49e-31
Family WD40-repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 2741-2793,2855-2905
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-16
Family PreBEACH PH-like domain 0.037
Further Details:      
 
Domain Number 4 Region: 477-600,638-841,932-988
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000699
Family Regulatory subunit H of the V-type ATPase 0.062
Further Details:      
 
Domain Number 5 Region: 1126-1274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000792
Family Laminin G-like module 0.074
Further Details:      
 
Weak hits

Sequence:  Bra000869
Domain Number - Region: 181-335
Classification Level Classification E-value
Superfamily ARM repeat 0.000144
Family Regulatory subunit H of the V-type ATPase 0.056
Further Details:      
 
Domain Number - Region: 1404-1509,1588-1784
Classification Level Classification E-value
Superfamily ARM repeat 0.00967
Family Mo25 protein 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra000869
Sequence length 3575
Sequence
MNWGTLLKDFKDKVGLADGTTAGDASRDLIPPPSSPPSPSSSSSYAASPQRDLTLLSPTS
RERYNLELEFRRYWEEFSSSTSEQEKEAALTMTVNTFCTIAKQHANIDHLVTMLVEIHVF
SFVIGRAFVTDIEKLKISSKTRSLDVEKVIKFFSQVTEEGVSHGENLLTAVEVLVSGNID
KQSLLDSGILGCLIHTLNALLTYSVASEGEKSVSLEEKVEESVIHIMKALASHPYAAQSL
IEDDSLRLLFKMVANGSVVAFSQYKEGLVSSRNIQLQRHAMQILGQLLVNDNGSTASYIR
KHYLVKALLMAIKDFDPDCGDSAYTMGIVDLLLECVELSYRPENGGVRLKEDIRNAHGYH
FLVQFALVLSSMPKNMVSASSHLSQHQNSGLDDSELQSPHSVNSRQNDEFGSQSFSPSLS
RLLDVLVTLAQTGPIELSGGSTSLLPQTNPTGYDETWEQGSGKVKDLEAVQMLQDIFLKA
ENKDLQAEVLNRMFKIFSSHMENYKMCQELRTVPLLVLNMGEFPSSLQEIILKILEYAVT
VVNCVPEQELLSLCFLLQQPINSELKHTILSFFVKLTSFDVQYKKVLCEVGVLEVLQDEL
RQHKLLMGPDLYSGVSNHLNRLPSSPSFKQHLDNKDAIISSPKLIESGSGMLPIFEVEST
ITVGWECMVSLLKKSEANQEAFRSANGVAGIFPCMVSLLKKSEANQEAFRSANGVAVILP
LLISDDHRTGVLRILSCLITEDANQVHHEELHAVIDVLKSGVVTGISGHQYKLHHEAICD
TMGSLWRILAVNGSAQRVFGESTGFSLLLTTLHTSPEEACRDESHLMVHIKLFKHVLRLM
TSAVCENAVNRMKLHNVIISQTFYDIFVESGLMCVDLERQVIQLLLELALEVLLPPFLTS
ESMASAEMAESEKASFLVKTPSGQFSPDKQRIYNAGAIRVLIRSLLFFSPKIQLEFLNLL
ERLARATPFNQENLTSAGCVELLLEIIHPFLPGSSPFLSHVLKIVEVLGAYRLSPSELKM
LCRYGLQMRVKNSGQAIVGMMEKLILMEDTGLEHVSLAPFVEMDMKKTGHASVQVSLGER
SWPPAAGYSFVCWFQSRNFFATQGKAAGEYEAGGSSKTQVLSGQQSEQNVFRIFSIGASN
ESPFYAELYFQEDDILTLATSSSNSLSFSGLEIEEGKWHQLAVVHSKPNALAGLFQASIA
YVYIDGKLRHMGKLGYSPSPVGKSLQVTIGTPATCARVSDLTWKIRSCYLFEEVLSSGCI
GFMYILGRGYKGLFQDAYLLRFMPNQACGGGSMAILDSLVTDMLSSSNSQKFEESNRQGD
SKADGSGIVWDLERLGNLSYQLAGKKLIFSFDGTCSEFMHAAGNFILLNLVDPLSAAASP
IGGIPRFGRLVGNASICRQNVIGNTIRHVGGMAVVIALVEAAESRDMLHMALSLLACALQ
QNSQNVKDMETYKGYHLLALFLRPKMALFDMQCLEIFFQISACEAFFSEPKKLERGQSTI
SMSPTKNVPENNYEDISLSKFQYETSSVGSHGYMDDFSGPKDSFSQLSELEIGDIPVETS
NCIVLSNADMVENVLLDWTLWVTAPVSIQIALLGFLENLVSMLRYRSHNLTILRRINLVE
QLLVTLQRGDVEVLVLEKIVVLLGCILEDRFLTSELENVVRFVIMTFNPPEIKSRNSPRR
ESMGKHVIVRNLLLEMLIDLQVTIKAEELLEQWHKMVSSKLITYFLDEAVHPTSMRWIMT
LLGVCLTSSPSFSLKFVTNGGYQGLTRVLQSFYDSPDIYYILFCLIFGKPVYPRLPEVRM
LDFHALVPNDGSRVELKFLDLLDSVVAMAKSTFDRLIMQSMIAHHSGNLSQASASFVAKL
VEGNVDMTGELQGDALMHKTYAARLMGGEASAPATATSIIRFMVDLAKMCPPFSAVCRSA
EFLQHCADLYFSCVRAAHAVKMAKQLSIKTEEQCLSGGDDSSAQGVFSNLPQDLDQSTKT
SISAGSYPQEQVSVSSEGMPLPSDYVVADKVEKILTTPSGASAKSFQDREYVKKLDGDRV
SPVSASSELEFRDCKGKSSKIQPTDSQSSESFSMLESPVVSEKSSRKGPFTSSTSPLPSH
ISVSEFDASSDHKSGSQGLSAAHTLFKISPKLLLETDESGYGGGPCSAGASAVLDFMAEI
CADLMTEQMKAVQTLESILEMVPLYVDPECVLVFQGLCLSRVMNYLERRLVRDDEEDDKK
LDKRKWSANLDAFCWMIVDRVYMGAFPLPTGVLRTLEFLLSILQLANKDGRVEEFTSSGK
GLLSIGRATKQLDAYVHSILKNTNRAILYCFLPSFLTTIGEKNLLSRLGLLVESNKRQPS
DEESGIDISTVLQLLVANKNIILCPSNLDTDLNCCLCVNLISLLHDQRKNVQNMASNIVK
HMLVHRRSASEDLLVRKPHRGQTLDVLHGGFDRLLTGNLPEFSKWLESSEETVKKVLDHG
AAVMWTQYIAGSAKFPDVRMKGMDGRRTREMGRKSRDISKLDVKRWEQLNERRHALDIVR
DTMSTELRIVRQNKYGSILHAESEWQNHLQQLIHERGIFPLRVSQGSGDLEWQLCPIEGP
YRMRKKLERCSLKVDSIRKLLEGKLELEEIELPKPKNEDGIVIFDKDCEPDFLLSELYSE
SFFEEADALKDIPSARNGWDNDGGSSSSETSLHNALDFSAKSSGTISVLISENTDEKSET
GSPRGSSSGNMDETRDVEEESEKELNDDGEYLIRPYLEHLEKIRFRYNCERVVGLDKHDG
IFLIGELCLYVIENFYIDDHSCICEKECEDELSVIDQALGVKKNVTEGLEFQSKSSPLWS
TNMKTGAVGARAWAYGGGAWGKEKVRVTGNLPHPWRRWKLDSIHEILKRDYELRPVAVEL
FSMDGCTDLLVFHKKEREEVFRNLIAMNLPRNRMLDTTISGSGKQESKEGSRLFKLMAKS
FTKRWQSGEISNFQYLMHLNTLAGRGYSDLTQYPVFPWILADYDSESLDLSDPMCFRKFD
KPMGCQTPEGEEEFRKRYDSWDDPEVPKFHYGSHYSSAGIVLYYLIRLPPFSAENQKLQG
GHFDHADRLFNSIKETWLSASGKGNTSDVKELIPEFFYMPEFLENRFNLDFGEKQSGEKV
GNVFLPPWARGSVREFIRKHREALESDYVSENLHHWIDLIFGYKQRGKAAEKAVNVFYHY
TYEGNVDVDAVTDPAMKASILAQINHFGQTPKQLFQKPHVKRRTDRKIPLHPLKHSTHLV
PRDIRKCSSSINQIITFHDKLLVAASNCFLKPRGYRKYIRWGFPDRSLRFMSYDQDKLLS
THENLHEGNQIECAGVSHDGRVVVTGADDGLLSVWRVSKDGPRGSRRLRLEKSLCAHTAK
VTCLRVSQPYMMIVSGSDDCTVIIWDLSSYNFVRQLPEFPVPVSAIYINDLSGEIITAAG
TLLAVWSINGDCLAVVNTSSQSPSDFIVSVTGSTFSDWLETKWYVTGHQSGSLKVWQMVH
CTDPVGAEIKSASNRTGWTNLVPEYKLLPHKELDCHKQPITALHLTADLKQLLSGDSGGR
LISWTVPDQILKASLKNALIAQNLKHHHLEARIGI
Download sequence
Identical sequences M4C9J0
Bra000869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]