SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra001616 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra001616
Domain Number 1 Region: 6-202
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.6e-47
Family WD40-repeat 0.00054
Further Details:      
 
Domain Number 2 Region: 645-707
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000266
Family Ran-binding domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra001616
Sequence length 728
Sequence
MDLPLRLDIKKKFAQRSERVKSVDLHPTEPWILASLYSGTVCIWNYQTQTITKSFEVTEL
PVRSAKFIPRKQWVVAGADDMYIRVYNYNTMDKLWDWENGWACTQIFEGHSHYVMQVVFN
PKDTNTFASASLDRSIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDQTA
KVWDYQTKSCVQTLEGHTHNVSAEIAEEVQSESKWKQLGELAMSSGKLQLAEDCMKYATD
LSGLLLLYSSLGDAEGMSKLASLAKEQGKNNVAFLCLFMLGRLEDCLQLLVESNRIPEAA
LMARSYLPSKVSEIVALWRKDLSKVNSKAAESLADPEEYPNLFEDWQVARSVEANAVEAR
GVYSAAENYATQADQPFITLVEAFRNLQVEAEEPFENGDGDHEVAEENGDAENEGGEEEE
NEEEVNQEEGVVDEDSTDGSAVLVNRSEGEEEWENAQQSPSKKRGALKEQSRDNPGLDDD
DDQDTTALESGTFKTASEEAVATRRIVRGVGCKSGTVITEEAKGDNGNSNTDKGSDCGVD
KSEAVNGGETAEDETKTTIETQKAKDDEGSDCGVDKDSAGGQTEKEGTDKNGDNSGFFTS
LELLPSSHQRKRFQWKQEKRTREQPSQLLIQYCSNTLKEDGKSVGKDKLILNASLYPEMK
LASMDKKGITFACVRESKSGLSTFALKFKDPAIVEKFRAVIEEHKKSKPMSVKAVAAPLK
TPENSPEG
Download sequence
Identical sequences M4CBN6
Bra001616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]