SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra003635 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra003635
Domain Number 1 Region: 69-163,191-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-29
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 
Weak hits

Sequence:  Bra003635
Domain Number - Region: 381-412
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00161
Family Pan module (APPLE domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra003635
Sequence length 439
Sequence
MKFSSTSVLCLTLSFFLIGAQAKVPVDEQFRVVNEGGYTDYSPIEYNPDVRGFQPFNDNF
RLCFYNTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADG
RMVWQTNTANKGAVGIKILENGNMVIYDKNGKFIWQSFDSPTDTLLVGQSLKLSGRNKLV
SRRSPSVNTNGPYSLVMEAKKLVLYYTTNKTPKPIAYYNYEFFSKITQLQSITFKAVEDI
FDSTWGLHMEGVDSGSKFNVSTFLSIPKHNATLSFIRLESDGNVRVWSYSTAATATAWDV
TYTAFTNDDTDGNDECRIPEHCLNFGLCKKGQCNACPSDKGLLGWDETCKTPSLASCDPK
TFHYFKIEGADSFMTKYNGGSSATEKACGDKCTRDCKCLGFFYNRKSSRCWLGYELKTLT
RTGDSSLVAYVKAPNANKK
Download sequence
Identical sequences M4CHF2
XP_009104565.1.100322 Bra003635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]