SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra003636 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra003636
Domain Number 1 Region: 92-168,196-217
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.23e-25
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 
Weak hits

Sequence:  Bra003636
Domain Number - Region: 402-434
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000334
Family Pan module (APPLE domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra003636
Sequence length 452
Sequence
MKLQLEILLATALAIATVSVVIAQVPPEKQFRVLNEPSYAPYITEYDAGYRFLSSENQSF
FTLPFQLMFYNTTPSAYVLALRVGSRRDLDYTRWIWDANRNNPVGDNSTLSLGRDGNLVL
AELDGQIKWQTNTANKGVTGFKILPNGNMVLHDKNDKFIWQSFDYPTDTLLVGQSLKLNG
VNKLVSRTSDVDGSDGPYSMVLGNKGLTMYVNKTGQPLAYGGWPSQDYRGTVTFTVRREF
DNLTEPSAYELLLEPAPQPTTTNPGNNRRLLQSRPLGILSKVNYNCTISYLRLGSDGSLK
AFSYFPAATYLEWEETFAFFSRNFVRPCGLPSFCGEFGYCSRGMCVGCPTPKGLFAWSEK
CSAPKTTEFCGGRNKGKTVKYYKIVGVEHFNGPYVNDGQGPVSVNECKAKCDRDCKCLGY
FYKEKDKKCLVAPLLGTLIKDANTSSIGYIKY
Download sequence
Identical sequences M4CHF3
XP_009104566.1.100322 Bra003636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]