SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra004179 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra004179
Domain Number 1 Region: 85-195
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.45e-28
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 
Weak hits

Sequence:  Bra004179
Domain Number - Region: 507-551
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0024
Family Protein kinases, catalytic subunit 0.015
Further Details:      
 
Domain Number - Region: 359-415
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00824
Family Pan module (APPLE domain) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra004179
Sequence length 551
Sequence
MKGVHNIYHHSYTFSFLLVFLALILFHPALSTYVNTMSSSESLTISSNRTLVSPGGVFEL
GFFKPSGRSRWYLGIWYKKVSQKTYAWVANRDNPLSNSIGTLKISGNNLVLLGQSNNTVW
STNLTRENVRSPVIAELLPNGNFVMRYSNNKDSSGFLWQSFDFPTDTLLPEMKLGYDFKT
GRNRFLTSWRSYDDPSSGKFTYELDIQTGLPEFILINRFLNQRVVMQRSGPWNGIEFSGI
PEVQGLNYMVYNYTENSEEIAYSFQMTNQSIYSRLTVSDYTLNRFTRIPPSWGWSLFWSL
PTDVCDSLYFCGSYSYCDLNTSPYCNCIRGFVPKNRQRWDLRDGSHGCVRTTQMSCSGDG
FLRLNNMNLPDTKTASVDRTIDVKKCEEKCLSDCNCTSFATADVRNGGLGCVFWTGDLVE
IRKQAVVGQDLYVRLNAADLDFSSGEKRDRTGTIIGWSIGVSVMLILSVIVFCFWRRRQK
QAKADATPIVGNQVLMNEVVLPRKKIHFSGEDEVENLELSLMEFEAVVTATEHFSDFNKV
GKGGFGVVYKV
Download sequence
Identical sequences M4CIZ5
Bra004179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]