SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra004182 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra004182
Domain Number 1 Region: 86-196
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-28
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Weak hits

Sequence:  Bra004182
Domain Number - Region: 360-403
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0392
Family Pan module (APPLE domain) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra004182
Sequence length 442
Sequence
MKGVHNIYHHSYTFSFLLVFLALILFHPALSTYVNTMSSSESLTISSNRTLVSPGGVFEL
GFFKPSALQRWYLGIWYRKVFDQKTYAWVANRDNPLSNSSGTFKISGNNLVLLGQSNNTV
WSTNLTRCNARSPVIAELLPNGNFVMRYSSNRDSSGFLWQSFDFPTDTLLPDMKLGYDLK
TGRNRFLTSWNSSDDPSSGNTTYKLDLRRGLPEFILINTFLNQRVEMQRSGPWNGMEFSG
IPEVQGLNYMVYNYTENSEEISYSFQMTNQSIYSRLTVSEFTLDRFTRIPPSWGWSLFWS
LPTDVCDSLYFCGSYSYCDLNTSPNCNCINGFVPKNPQQWDLRDGTQGCVRTTQMSCSGD
GFLRLNNMNLPDTKTATVDRTIDVKKCEEKCLSDCNCTTFAVEDVRNGGLGCVFWTGELV
EMRKYAVGGQDLYVRLNAADLG
Download sequence
Identical sequences M4CIZ8
Bra004182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]