SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra004920 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra004920
Domain Number 1 Region: 2219-2509
Classification Level Classification E-value
Superfamily BEACH domain 2.09e-123
Family BEACH domain 0.00000000986
Further Details:      
 
Domain Number 2 Region: 2632-2702,2741-2926
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.61e-34
Family WD40-repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 2099-2208
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-25
Family PreBEACH PH-like domain 0.0018
Further Details:      
 
Domain Number 4 Region: 440-582
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000696
Family Clostridium neurotoxins, the second last domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra004920
Sequence length 2945
Sequence
MEEDDERKLAEASGHHPIEAFDAALQGVSSAGGDFKDDDFEQVSLGDQEKSVNMSHGDVK
EPGSTSKSDHEFGGTEGVAYHLSGTQEAYDLMPMDDVESDRVSSDGPVREASYSMTQPIS
ATSLDSINHPGSGYSPVHSPQKPKPKATTSNVSPELLHLVDSAIMGKPESLDKLKNVVSG
IESFDSGEDPESTAFLVVDSLIGTMGGVESFEEDEDSNPPSVMLNSRAAIVSGELIPWLP
CLGDSLHFMSPRTRMVRGLLVILRSCTRNRAMCSTAGLLGVLLRSVKEVISKDADMKWSS
AAVLLLCIQHLAGHSLSVDDLHMWLEVTKTTLTTAWSSPLMLALEKVMSGKESRGPACTF
EFDGESSGLLGPGESRWPFTNGYAFATWIYIESFADTLNAATAAAAIAAAAAAKSGKTSA
MSAAAAASALAGEGTAHMPRLFSFLSADNQGIEAYFHAQFLVVESGSGKGRKSSLHFTHA
FKPQCWYFIGLEHSGKQGLLGKAESELRLYVDGSLYESRPFDFPRISKPLSFCCIGTNPP
PTMAGLQRRRRQCPLFAEVGPVYIFKEPIGPERMARLASRGGDVLPCFGNGAGLPWLATN
EHVRNSADESSLLDAEIGGYIHLLYHPCLLSGRFCPDASLSGATGTLRRPAEVLGQVYVA
TRMKPVESFWALAHGGPMSLLPLTVSNVNKDSLEPCPGNNPLSLSTITLAAPVFRIISVA
IQHPGNNEELCRNQGPEILARILSYLLHSLASLDRKHDAVGEEELVAAIVSLCQSQKINH
VLKVQLFRTLLLDLKIWSLCNYGLQKKLLSSLQDMVFTEAKAMRDADAIQLLLDGCRRCY
WMISEQDSVTSFPLDGNTRQMGEVNALIDELLVIIELLMGAASPSLAADDLRRLLGFIID
SPQPNQVARVLHLIYRLVVQPNSARATMFAEVFITSGGIETLLVLLQREAKTGEGNVLAG
KSETRSFSDQSEKRQFNESGSVKQLESDPLDNEINIDLCGPDGNSVEDDNIGSLNESESI
QQEKEDKSAPVICDSDSASVSNFKNTERISSEIGGISLSISADNARNNVYNVDNSDAVVV
GIIRLIGALISSGHLTFDLGGRSDVTSNILGSGLHENGGTMFDDKVALLLFALLKAFQAA
PNRLMTDNVYTTLLGASINASSTEDGLNFYDSGHRFEHSQLLLVLLRSLPFASKNLQSRA
LQDLLFLACSHPENRSSLTTMEEWPEWILEILITNYEKDAGKHSASAGSSEVEDMIHNFL
IIMLEHSMRQKDGWKDIEATIHCAEWLSIVGGSSTGEQRIRREESLPIFKRRLFGGLLDF
AARELQAQTQVIAAAAAGVAAEGLAPKDAKAGADNAAQLSVFLVENAIVILMLVEDHLRL
QSKQTCAANAVDASPSPLSFVSPLKNRTSTLTAIGESPEVPSSRASVSSDSGKVPLDILA
SMADASGQISAVAMERLTAAVAAEPYESVSCAFVSYGSCAMDLAEGWKYRSRLWYGVGFP
SKNSCFGGGGSGSDSWKSTLEKDSHGNWIELPLVKKSVSMLQALLLDESGLGGGLGIGGG
SGTGMGGMASLYQLLDSDQPFLCMLRMVLLSMREEDYGEDNMLMRNVSLERSSGNSISLD
SGSQMSMRQSRSALLWSVLSPILNMPISDSKRQRVLVTACVLYSEVWHAISRDRKPLRKH
YIEAIVPPFIAVLRRWRPLLAGIHELATADGMNPLVADDRALAADALPVEGALSMITPEW
AAAFASPPAAMALAMIAAGAAGWEAPPPPTPSHLRRDSSMLERKSAKLQTFSSFQKPLEA
TKNNIPPRPRDKAAAKAAALAAARDLERNAKIGSGRGLSAVAMATSAQRRNISDMERLQR
WNSSEAMGVAWMECLQPVDTKSVYGKDFNALSYKFIAVLVASFALARNMQRSEIDRRLQD
DILAANRLSLGGRGWRKLIRYLVEMRCFFGPFGDELCSPERVFWKLDSMESFSRMRQCIR
RNYSGTDHLGAAANYDDQADTKSDNASKGSPSDPPVLAADVISMEIAYEDDEHGEGDHLD
VKVNAEEHRRENEDRIAGSHEHASRTSAGTSDPRPSNDPELARDSSVAAAGFVPSELDER
ILLEFPTSMVRPLRVVKGTFQITTRRINFIVDNSESQNMTDHSDGSQLGGQEKDRSWPMS
SLHQIYSRRYLLRRSALELFMVDRSNFFFDFGNTEGRKNAYRAIVQARPPHLNNIYLATQ
RPEQLLRRTQLMERWARWEISNFEYLMRLNTLAGRSYNDITQYPVFPWIISDNSSESLDF
SNPSTFRDLSKPIGALNPERLKKFQERYSSFEDPVIPKFHYGSHYSSAGAVLYYLARVEP
FTTLSIQLQGGKFDHADRMFSDIPATWNGVLEDMSDVKELVPEMFYLPEVLTNENSIDFG
TTQLGEKLDAVKLPPWAKNPVDFVHKQRKALESEHVSAHLHEWIDLIFGYKQRGKEAIMA
NNVFFYITYEGTVDIDKITDPVQQRATQDQIAYFGQTPSQLLTIPHMKRMPLKDVLHMQT
IFRNPKEIKPYGVQNPERCNLPASAIQASSDSVVIVDMNVPAARVAQHKWQPNTPDGQGT
PFLFHHGKATATSTSGGSLMRMFKGPASSGTDDWQFPQAQAFATSGIRSSSVVAITSDGE
IITGGHADNSIKLVSSDGAKTLETAFGHCAPVTCLALSPDNNFLVTGSRDCTVLLWRIHK
AFTSRTSVSEPSTGSGAPSSANNTNVANNTLANKGKKCRIEGPIQVLRGHRREVVSCCVS
SDQGVVVSSSESSDVLLHSIRKGRLIRRLVGVTANSLCISSDGVIMAWSSSEGSISVFTI
NGVLIAKAKLPFSCSISCMEMSMDGQNALIGMNSCSSMDYSSSNEDGKEIERLDVSSPSI
CFLNLYTLQVFHVLKLGQGQDITALALNVDNTNLLVSTEDKQLIIFTDPALSLKVVDQML
KLGWE
Download sequence
Identical sequences M4CL34
XP_013748138.1.73403 XP_018514618.1.100322 Bra004920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]