SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra006461 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra006461
Domain Number 1 Region: 80-165,197-225
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.16e-19
Family alpha-D-mannose-specific plant lectins 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra006461
Sequence length 405
Sequence
MALSPILVPLLLIPIFLGSVSAISPLKTDTLKPGQQLRDWEQLISAGEAFTLRFFTPRES
STFLLGSGAGLRYICIWSQTDPVWVGNPTEPVSDSSGSLSIDTNGALKITRANASPIMVS
PHLSLAGNVSATLLDSGNFVIRDAGRGGGGGPGRILWQSFDHPTNILLPGMKIGFNLKTK
KEISVTSWTSNQVPTPGAFRLGLDPSGANQLLVWRHGEIYWSSGILTNNGSSQLALELSR
RYNIDYEFKFHSDKRMNYFSYSVKKTKGSVSSSWFLDTLGQITVTTSFRSNTCAGGTSES
SGPCKKYLKSSSAICIAEKPTACRKGTEYFEPRRGYMMDNAYYGDGLSSGISDCHGSCWR
NCSCIAFQSLPRGRCQYWGKGSTFVPYDNFNGGLVLIVYVLDSEK
Download sequence
Identical sequences M4CQH2
XP_009131670.1.100322 Bra006461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]