SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra007876 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra007876
Domain Number 1 Region: 381-770
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.4e-94
Family Regulator of chromosome condensation RCC1 0.00099
Further Details:      
 
Domain Number 2 Region: 148-255
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-27
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 
Domain Number 3 Region: 769-840
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.4e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0026
Further Details:      
 
Weak hits

Sequence:  Bra007876
Domain Number - Region: 980-1055
Classification Level Classification E-value
Superfamily Tropomyosin 0.00641
Family Tropomyosin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra007876
Sequence length 1158
Sequence
MPSNSGDDNVLQILIKNFDVLALYASVKAIETKSLAEDEQWLTYWVLYAIISLFELIFSK
LLDWFPIWPFLKLIGICWLVLPQFNGAEHVYRHFIRPFYMNPQRASTNIWYVPQKKLNFF
PKRDDDDILTAAEKYMEKHGTDAFERMIVRAITSLKKGSYLLKYGRRGKPKFCPFQLTSD
ESTLVWYSGKEEKQIKLSQVLRIVPGQRTATFKRYPRPEKEYQSFSLICPDRSLDLICKD
KDEAEVWVVGLKALITRVKISKWKNTIKPEITSPECPTPQARRVSPFVSILDQVTQPSTE
TSTPNRLGKVFSDIVSITAPANNNQTEANTLNPNLYCPISPGNVENPNSRFSTGGDLARL
SLSSAVSTSSHGSYHEEFDALGDVFLWGEAISDGVLSGTGKTLHSTTEDALLPKTLESTI
VLDAQNIACGRCHAVLVTKQGEIFSWGEGTGGKLGHGLEKDTHQPKFISSVRGMNFKSLA
CGEFHTCAVTQSGDLYTWGDGTRNVDLLGHGSESSCWIPKRVTGVLQGMHVSYVACGPWH
TAVVASSGQLFTFGDGCFGALGHGDRTSSSVPRVVESLSEVRVMKVACGFWHTAAVVEVT
NEASDAELYSSCGQLFTWGDGEKGQLGHGDNSAKLLPECVTSLTDENICQVACGHSLTVS
LTSNGHVYTMGSPAYGQLGNPTAKEKVPSRVEGDIAETCVEEIACGSHHVAVLTSKSEVY
TWGKGLNGQLGHGTVENKREPAVVGFLKEKQVKAITCGSNFTAVICLNKWVPGSEHSLCA
GCRNPFNFRRKRHNCYNCGLIFCKVCSSRKSLRAALAPDMNKPYRVCYGCFTKLKRSREL
SPPPPTPRTRNLLNMRKSTDVSEKTPKLLSPHSRIASADSLVQYGEGRHSKRDVKPEVSN
SNVFALGSVQPAMSPLLRGSIAWPRISKNMIVKVPGSRVSSRTASPVSVKSTSPRPSHEV
TTDESKHIKDSFGQEIVGLKEHVEQLTSKTQQLEEELEKTKRQLKVVTAMAADEAEENRS
AKEVIRSLTTQLKEMSGRVPQKDDTSTNLRHTEKETTLESQTQTSSQTHIRSMVPHDSQS
ENNLSKSFVNGHRRHNEKAERVVQDEPGVYLTLLSLPGGGNELKRVRFSRKQFTEEQAEK
WWGENGGKACERHNILVS
Download sequence
Identical sequences M4CUI1
Bra007876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]