SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra008080 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra008080
Domain Number 1 Region: 108-196
Classification Level Classification E-value
Superfamily PH domain-like 0.0000585
Family Pleckstrin-homology domain (PH domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra008080
Sequence length 739
Sequence
MVSFAGFAFITGFLLGILTIVAAEVAAFLYLLKRLNRKRNLHESNKTSSDPPNSIDFSLN
KQGVIWVLESDESLKDWMKEKLPKEQNKKKKKDILEVHPVRKSAHIKDHKLIFSNGDGTQ
KIVSLKGCSVEAVSGSELPTRKWAKRYPIKVESKTSDLNKGSRVFYIFLETSWEKESWCK
ALRLAACNDQERSTWPTQLKHDFQNYIASLNVAYPSFMKQPSSGFDVESLDNKGVKIDAP
SSKVRLFWKKFSRKKVPNREDKKTSSTRHYQDSSGSSGRSTPARKVRDNNIPEETEVQAF
SRSWSHVSHVSDADSEDKFYTDEGTLAWNLLISRLFFDVKLNTGIKNIVHERIQRVLSNM
RLPSYIGDLICCDVKIGNLPPYIHGARVLPVEMNGVWAFELDIEYTGGAGLVVETRVDAR
AEDLQKRIAEGKLQPSPSGDVPIDLLEGLEEFEKQLSVPGGTVKVKTGGSEKPDESKGSK
GTNNGSKWKSILKNIAEQVSQVPINLSIGVSSLRGTLRVHMKPPPSDQLWLSFTTMPDIH
FDLVSSVGDHKITNSHVATFLINKFKNGIREVMVLPNCENVTIPWMMAEKDDWVQRSVAP
FMWLNQDSDSDHDSFEAADVKPKADKPPSPKKVANVHQKPRNDEEPVASSPSAANSAAPI
VESDSSSEDTIARGGNDEETTPASVQSSSRSIFSSEEDDLKGKKIGTKERMSGFRKKFGE
KFEEKKRHVEERSNRLLKR
Download sequence
Identical sequences M4CV35
XP_009127977.1.100322 Bra008080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]