SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra008202 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra008202
Domain Number 1 Region: 185-251
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.31e-20
Family DNA-binding domain from rap30 0.003
Further Details:      
 
Domain Number 2 Region: 9-119
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000000165
Family Rap30/74 interaction domains 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra008202
Sequence length 260
Sequence
MEDDRSNIHELDLEKSDRPVWLMKSPVVVAKAWGKQAPSSSSSSSGFNSLAKVVESVDPL
QAETEFFMEMVGAEYGNMPKSYALNMFKDFVPMGIFSEANLGDPASEGKVEHKFDMKPHG
EDIEEYAKLCRERTSKSMVKSRQIQVIDNDRGVHMRPMPGMLGLVSSNSKEKKKPPPVKQ
TEVKRTRRDRGELEAIMFKLFEGQPNWTLKQLVQETDQPAQFLKEILNELCVYNKRGSNQ
GTYELKPEYKKAGEDDTGGE
Download sequence
Identical sequences A0A078HQJ9 M4CVF5
Bra008202 XP_009128108.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]