SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra008330 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra008330
Domain Number 1 Region: 53-90,126-184
Classification Level Classification E-value
Superfamily PH domain-like 7.91e-20
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra008330
Sequence length 258
Sequence
MSSPLAAKSNPTTRSISLNIPHSARPNRHQDLRYSLSAGPRTNEDRPQSGNGVAGILYKW
INYGQGWKRRWFVLQDGVLSYYRIHGPDKISLSVEMDRRSKLIGGESLRFICRHSKRGDV
HSPGKPLGQIHLKVSSIGQGISDSKRFTVFTGTKRLHLRAASSEDRTAWIEALHAVKETF
PRMSNEELMATTTNVSISTDKLRQRLMKEEVDETIIKDCEDIMKNNFIALHNEVMTLKQY
QCHLVDTLKNVNSVPELE
Download sequence
Identical sequences M4CVT3
XP_009128248.1.100322 Bra008330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]