SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra008551 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra008551
Domain Number 1 Region: 29-210
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.7e-69
Family Inorganic pyrophosphatase 0.00000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra008551
Sequence length 214
Sequence
MSEEVKENQSGKLQKPTPRLNERILSSLSKRSVAAHPWHDLEIGPGAPVIFNVVVEISKG
SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFL
RARAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLTEIRRFFEDYKKNENK
EVAVNDFLPNGPAVEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences A0A0D3AS94 M4CWF4
XP_009128516.1.100322 XP_013618648.1.26608 XP_013719426.1.73403 XP_013731710.1.73403 Bra008551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]