SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra008838 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra008838
Domain Number 1 Region: 6-241,290-315
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.44e-64
Family BAR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 496-632
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.92e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00028
Further Details:      
 
Domain Number 3 Region: 650-675,727-807
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-23
Family Ankyrin repeat 0.00077
Further Details:      
 
Domain Number 4 Region: 293-333,374-447
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-21
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra008838
Sequence length 826
Sequence
MHFTKLDDSPMFRKQLQSMEESAEILRERSLKFYKGCRKYTEGLGEAYDGDIAFASALET
FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHILNDRLLQFANMDLHEVKE
ARKRFDKASLTYDQAREKFLSLRKGTKSDVAAALEQELHTSRSMFEKARFNLVTTLSNVE
AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALDEK
MQEYKRQVDRESRYGSNSANGSPNGDGIQAIGRSSHKMIDAVMQSAARGKVQTIRQGYLS
KRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSKPSGSGSQLSGQRNSSELGSGLLSRWLSS
NNHGGGVHDEKSVARHTVNLLTSTIKVDADQSDLGFCFRIISPSKNYTLHAESALDQMDW
IEKITGVIASLLSSQVPGSPMESGHHRSASESSSYESSEYDHPTTDEFVCERSFMGYNER
SSRNFQPQRSIRKGEKPIDVLRKVFGNDKCADCGAPEPDWASLNLGVLVCIECSGVHRNL
GVHISKVRSLTLDVKVWEPSVITLFQALGNNFANTVWEELLHSRSAFHVDPGLTGSDKSR
VLVTGKPSYADMISVKEKYIQAKYAEKLFVRRSRDCDFPQSVAQQMWDAVSANDKKSVYR
LIVNGEADVNSVYDQPSSSSSLTLSRVMLIPERPPTREDVLLKLRNELLDRTSSGFSSSI
PPEETGGCSLLHCACEKADIGMVELLLQYGANVNATDSSGQTPLHYCILRGKAVVARLLL
TRGADTEAVNGEGKTALDIAAESKFTDAEVLSLLSEAANGYNHRQC
Download sequence
Identical sequences M4CX91
Bra008838 XP_009121775.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]