SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra009516 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra009516
Domain Number 1 Region: 82-155,186-202
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000122
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 
Weak hits

Sequence:  Bra009516
Domain Number - Region: 216-279
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000314
Family alpha-D-mannose-specific plant lectins 0.0095
Further Details:      
 
Domain Number - Region: 354-390
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000432
Family Pan module (APPLE domain) 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra009516
Sequence length 482
Sequence
MEGLCFRFLLLFVFLLCSHTRHQVNATEPVLELTKGFEAKPDSSIDSFQPLLTDPSGNFS
FGFLRLNGSRLTLAVTHPNLTDPLWVFDPTRTASWSHKTKLFFNGSLVVSDPSSRVEWST
HTNGDRLVLRNDSNLQVVSTSSSSIEWESFDFPANTLVENQNFTSTMALVSSDGLYWMRL
GRDFIGLYAKVSDDSHSQQFYWKHSALQAKAKIRDGSGPIHARINPNGYLGMYQTGTVPV
DVEAFNSFQRPVNGLMILRLESDGNLRGYLWDGSRWALNYEAIRETCDLPNPCGPYSLCT
PGSGCSCIDNSTVIGECSRGGSRAADFCGGKTEKFKTVRRGGVEVPFKELMDHKTTSSLG
ECEEMCVEDCKCFGSVYNNGSGFCYLVNYPIRTMLGVADPSKMGYFKVREGVGKKRSRVG
LTVGMSLLAVIALALTVAMVYVAFRIWSREKHALEGEDGGLSPGPYKNLGSDSFSSVEMS
RR
Download sequence
Identical sequences M4CZ69
XP_009122680.1.100322 Bra009516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]