SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra012841 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra012841
Domain Number 1 Region: 83-216
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-18
Family alpha-D-mannose-specific plant lectins 0.0044
Further Details:      
 
Weak hits

Sequence:  Bra012841
Domain Number - Region: 350-385
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000259
Family Pan module (APPLE domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra012841
Sequence length 466
Sequence
MVMKIITFSFLICLFSKLQGHCKSDINLGFTLPLSAPIEYTPGFIGKAYIMETETSSRRE
PSFKAALTMESSEYKGRYLCSIQVFFGDVRVWSSGHYTKMYVSNKCIFELTEDGDMRLKR
SNKRVGWRSGTSGQGIERLEIQSTGNLVLLDAMNMIKWQSFNFPTDVMLSGQRLDVATQL
TSFPKDSTMFYSFEVLRDKIALFLNLDKLKYSYWEYKPIENKTVNFLRLGAKGLDIFDDN
SHRIGRIEQPLTRFLAIGNITGNLGLYSYKPDKGKFEATFQALSNTCDLPVACKPYGICT
SSKSCSCIKVMSNGDCNSNEEEWLSMKRLCDHEMVELEGVTTVLRNGTEARNVSKERCEE
LCKKDCECRGASYSVSEESCVMYGVVMGVKEIERESGLSYMVKIPKGVRLSDEKSNVRKW
VVGLVGGIDALVILLLLSGFGFYYIRKRRKSLSQPQPQLQEEPIAE
Download sequence
Identical sequences M4D8N1
XP_009136630.1.100322 Bra012841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]