SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra013624 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra013624
Domain Number 1 Region: 345-719
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.96e-111
Family Oxysterol-binding protein 0.001
Further Details:      
 
Domain Number 2 Region: 59-89,125-181
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra013624
Sequence length 727
Sequence
MRVKELHPLCCITLESPHALDDNKPPPEPVTNLTRSRSLPATSLTGGSNRRSLASAGSVA
GILYKWTNFSKGWRSRYFLLRDGILSYSKIRRPENLNLLSSSDDVRLIGNISADRLSRMD
SCSGRRKQEKSVGIVHLKVSSFRESKSDDRKFYIFTATKTLHLRTDSISDRAAWLQALAS
AKCIFPLRSLNGDFSFTSPKDLSISTERLKKRLQEAGMNENLVKDCEQIMLSEFSEMHGQ
IKLLHEERTNLFDALRQLEEANLEAGASGIHSSLGRGKYSECSTTASSDDKQEFEDVSEE
DEPSFHDTKEYFNEPNVGSGSNLSNNSGYADIKRRTKLPDPAEKEKAVSLWSMIKDNVGK
DLTRVCLPVYFNEPISSLQKCFEDLEYSYLLDRAYEHGKSGNGLLRALNVAAFAVSGYAS
TEGRHCKPFNPLLGETYEADFPEKGIRFFSEKVSHHPTVIANHCEGKGWKFWGDTNLRSK
FWGRSIQVEPVGVLTLEFDDGEVFQWSKVTSTIYNIILGKLYCDHHGVMQIRGNRQHSCT
LKFKEQSILERNPHQVNGFVEDVAGQKAATVFGKWDDSLYYVAGDGVSKTKVSDPASNAS
LLWRRTKPPLNVTRYNLTSFAITLNELTPGLKEMLPPTDSRLRPDQRHLENGEYEKANLE
KQRLERRQRMSRQLQESGWRPRWFEKQGENETFKYTGGYWEARGHRKWDDCPNIFGEFTE
EQLADSA
Download sequence
Identical sequences M4DAW4
XP_009135974.1.100322 Bra013624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]