SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra014101 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra014101
Domain Number 1 Region: 2606-2733
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000108
Family Synaptotagmin-like (S variant) 0.024
Further Details:      
 
Domain Number 2 Region: 847-943
Classification Level Classification E-value
Superfamily PH domain-like 0.0000139
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra014101
Sequence length 3654
Sequence
MFEAHVLHLLRRYLGEYVHGLSTEALRISVWKGDVVLKDLKLKAEALNSLKLPVAVKSGF
VGTITLKVPWKSLGKEPVIVLIDRVFVLAYPAPDGRTVKEEDMEKFLETKLQQIEEAESA
TLEARAKSKLGSSPAGNSWLGSLIATIIGNLKISISNVHVRYEDSTSNPGHPFASGITLA
KLAAVTMDEEGNETFDTSGALDKLRKSLQLERLALYHDSNSSPWEMEKQWDDISPVEWVE
MFEDGIKEQTAHNIKSKWALNRRYFLSPINGSLKYHRLGNQERNNQEIPFERASVNLNDV
NVTITEEQYHDWIKLVEVVSRYKTYMEISHLRPMVPVSEAPRLWWRFASQASLQQRRLCY
RFSWDSIHHFCRLRRRYIQLYANFLQLSSNANNPEMREIEKDLDSKVILLWRLLAHAKVE
SVKSKEAAEQRKLKKGGWFSFKWRTESEDDPEADTVAEGSKSMEEGLTKEEWKAINKLLS
HQPDEEMNLYSGKDMQNMTHFLVTVSIGQGAARIVDINQTEVLCGSFEQLDVTTKFRYRS
TQCDVSLRFYGLSAPESSLAQSVSSERKTNALMASFVKSPIGENIDWRLSATISPCHATI
WTESYDRVLEFVKRSNAISPTVALETAAVLQMKLEEVTRRAQEQLQIVLEEQSRFALDID
LDAPKVRIPLRASGSSKCSSHFLLDFGNFTLTTVDTRSEEQRQNLYSRFCISGRDIAAFF
TGCGSDNKGCSLLMEDFTNQPMVPPILEKGDSVYSLIDRCGMAVIVDQIKVPHPSHPTTR
ISIQVPNIGVHFSPARYMRIMQLSDILYGAMKTYSQTPLDDIPDGIQPWSPADLVSDARI
LVWKGIGNSVATWQPCHLVLSGLYLYTYESEKSLDYQRYLCMAGRQVFEVPPENVGGSPY
CLAVGLRGTNLKKALESSSTWIIEFQGEEKAAWLRGLVQATYQASAPLSGDVLGPTRDGD
GDFHEPQTGNLKAADLVINGALVETKLYLYGKIKDECDEKVEEVLLLEVLAAGGKVHMIS
SESGLTVRTKLHSLKIKDELQQSGSAQYLAYSVLKNEYIQDPRRCDAYDKEMSVGHADDE
DAFTDALPEFLSPTEPGTPDMDMIQCSMMMDSDEHVGIEDAEGGFHEKDTSQGKGLCDEV
FYEVQGGEFSDFVSVVFLTRSSSSPDYNGIDTQMSIRMSKLEFFCSRPTLVALIGFGFDL
SAATYVEDDKDANNLAFEKSGSEKEAKDEGGRIEGLLGYGKDRVVFYLNMNVDSVTVFLN
KEDGSQLAMFVQERFVLDIKVHPSSLSIEGTLGNFKLCDKSLDSGNCWSWLCDIRDPGVE
SLIKFKFNSYSAGDDDYEGYDYSLSGRLSAVRIVFLYRFVQEVTAYFMGLATPHTEEVIK
LVDKVGGFEWLIQKYEIDGATALKLDLSLDTPIIVVPNDSLSKNYIQLDLGQLEISNEIS
WHGCPEKDPSAVRVDALHAKILGLNMSVGINGSIGKPMIREGQGLDIFVRRSLRDVFKKV
PTLSVEIKIDFLHGVMSDKEYDIIVSCTTMNLFEEPKLPPDFRGNSPGPKDQMRLLVDKV
NLNSQTIMSRTVTILAVDINYALLELRNSVSEESPLAHVELEGLWVSYRMTSLSETDLYV
SVPKVSVLDIRPNTKPEMRLMLGSSVDASKQVSSESFPFSLNKGSFKRANSRAVLDFDAP
CSTMLLMDYRWRASSQSCVLRVQQPRILAVPDFLLAVGEFFVPALRAITGRDETMDPTND
PITRRSGIVLYEALYKQIEEVVYFSPCRQLVADSLGVDEYTYDGCGKNGSLLSKCVYLSN
DSSCLFSPEDGVDISMLENTKSNSESVLSNAHKSSDVSDACQSDLKAGQNFTFEAQVVSP
EFTFFDGTKSSLDDSSAVEKLLRVKLDFNFMYASKENDIWVRALLKNLVVETGSGLIILD
PVDISLGYTSVKEKTNMSLTSTDIYIHLSLSALSLLLNLQSQVTGALQSGNAIPLASCTN
FHRIWVSPKATVSDNYTIDSFVLGMYPENGPRNNLTIWRPQAPSNYVILGDCVTSRAIPP
TQAVMAISNTYGRVRKPTGFNCIGLFSVIQGSGGDNGQHSIDSDECSLWMPVAPAGYTAM
GGVANLGSEPPPDHIVYCLRSDLVSSSSFSECIYTVPSNSLFESGFSIWRADNVLGSFYA
HSSTAAPSKQYSPGLSHCLLWNPLQMKTSPISDSSPTGGSQSEQTSDQTGNSSGWDIVRS
ISKPTSYHVSTSNFERIWWDKGGDLRRPVSIWRPIPRPGFAILGDSITEGLEPPALGILF
KADDSEIAAKPVQFSKVAHIVGKGLDEVFCWFPVAPPGYVSLGCVLSKFDEAPRVDSFCC
PRIDLVNQANIYEASVTRSSSSKSSQSWSIWKVDNQACTFLARPDLKRPPSRLAFAVGES
VKPKTQENVNAEIKLRCFSLTLLDGLHGMMTPLFDTTVTNIKLATHGRPEAMNAVLVSSI
AASTFNPQLEAGEPLLEPFDGIFKLETYDTALSQSSRPGKRLRIAATNILNLNVSAANLE
TLGDTVVSWRRQLELEERAAKMKEESGVSRESGDLSAFSALDEDDYQTIVVENKLGRDIY
LKKLEENSDVIVKLCHDENTSVWVPPPRFSNRLNVSDSSREARNYMTVQIVEAKRLHIVD
DGNSHNFFCTLRLVVESHGAEPQKLFPQSARTKCVKPSTTVINDLMECTSNWNELFIFEI
PRKGLARLEVEVTNLAAKAGKGEVVGSLSFPIGHGENTFRKVASVRSLYQSSDAENISSY
TLQRKNAEEIHDNGCLLVSTSYFEKTTIPNTLRNMESKDFADGDTGFWIGVRPDDSWHSI
RSLLPLSVAPKSLQNDFIAMEVSMRNGRKHATFRCLATVVNDSDVNLEISVSSDQNVSSG
PSNHNALIASRSSYILPWGCLSKDNEQCLHVRPRVDPPHHSYAWGSCIAVSCGCGRDQPF
VDQGLLTRQQTFKQSSRPASFVLKLNQLEKKDMLFCCQPATGSKPFWLSIGADASVLHTD
LNTPVYDWKISINSPLKLENRLPCPVKFTVWEKTKVGTYLERQHGVVSSRKLAHVYSTDI
QRPVYLTLAVHGGWALEKDPIPVLDLYSSDSVTSFWFIHQQSKRRLRVSIERDVGETGAA
PKTIRFFVPYWITNDSYIPLGYRVVEIEPSENVEAGSPCLSRAPRSFRKNPGFSMERRQQ
RKNVRVLEVIEDTSPMPSMLSPQESAGRSGVVLFPSQKDSYGSPRIGIAVAARDSEMYSP
GISLLELEKKERIDVKAFCSDASYYKLSAVLNMTSDRTKVIHLQPNTLFINRVGVSICLQ
QCDCQTEEWINPSDPPKLFRWQSSTRTELLKLRVQGYGWSTSFSVCSEGAVRVPIGREDG
TDQLLLRVQVRSGTKNSRYEVIFRPNSVSGPYSGVLDLLSKTTEGANAMRMKIAAAITSD
EQLLRRRLPRAVGADSLLRPYNEYRAQGQVILQLAESGSFLGQVDLFKVRGKFALTDAYE
SHFILPKGKVLMITHRRVILLQQPSNIMGQRKFIPAKDACSIQWDVLWTDLVTMELTDGK
RDQPNSPPSRLILYLRSKSHDSKDLRSKLHDSKEQFRIVKCSPNTKQAFEVYSAIDQTIN
LYGQIASKGLVKTKVTRPYSPMSESSWAEGGSQQMPASVAPTSTFGTSPTTSSS
Download sequence
Identical sequences M4DC88
Bra014101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]