SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra014282 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra014282
Domain Number 1 Region: 168-263
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-28
Family B3 DNA binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 48-107
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000229
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra014282
Sequence length 339
Sequence
MVILHEISNEAKTTTEASGSSNSFLRLATKPTVSTTTRIALSNTATTKYKGVVQQQNGHW
GAQIYADHRRIWLGTFKSAAEAAAAYDSASIKLRGFDANSHRNFPWSELTVHEPDFQILY
TTEAVLNMIRDGSYHHKFRDHVMSRSRMANFNIVESKQESNKCFSCTQLFHKELTPSDVG
KLNRLVIPKKYAVKHLPFISDDQEEGEAVEDVEVVFYDSTMRQWKFRYCYWRSSQSFVFT
RGWNGFVKEKNLKEKDVIVFYSCDVPSNVRRLEGQRDKFLMIDVDHKGFVAPKEENKMVH
NRSEGEMKTENFFNSKLEDEETKQEEKKGGFMLFGVRIQ
Download sequence
Identical sequences M4DCR5
Bra014282 XP_009107560.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]