SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra014782 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra014782
Domain Number 1 Region: 42-151
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.96e-21
Family alpha-D-mannose-specific plant lectins 0.0054
Further Details:      
 
Weak hits

Sequence:  Bra014782
Domain Number - Region: 290-348
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00384
Family Pan module (APPLE domain) 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra014782
Sequence length 372
Sequence
MISPGNVFELGFFKLAGSNTKEDGERWYLGLWFYKASSKMNPLWVANRESPLYDSKGALK
IYKSNLVIVNQSGNIIWSSSNAVVPSPPKTSSVVAELLSNGNFVLRYSDDNRGDSFLWES
FDYPTDTLLPGSDLAKGVNRSLTSWISNNNPSTGIYSYALLSKNQEMFLLDAKSSPVYRR
SFGLKTPYALGNGYYLLLLQVTYDGLLQQFSWSPTTREKTLLWRGPRDRCDLYGKICGSN
SVCSLEKVDVHVFAGCTCFKGFKPRNWRGWWLRNMTEGCQRISRLNCTGNGFQVLKNVKL
PDTKDAGLERSIGPKECRQRCIEDCSCTGFANVELDCFLYSSDLVDLRTLQSGQQLYIKV
ATSYLGKFFISS
Download sequence
Identical sequences M4DE63
XP_013745328.1.73403 Bra014782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]