SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra017901 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra017901
Domain Number 1 Region: 75-339
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.3e-29
Family G proteins 0.0022
Further Details:      
 
Domain Number 2 Region: 604-727
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-20
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra017901
Sequence length 945
Sequence
MEAIDELSQLSDSMRQAAALLADEDPEESSSSRRPATSLNVVALGNVVGVSFLFDVCLYL
VSVDFGFRMVDLNEGAGKSAVLNSLIGHPVLPTGENGATRAPIIIDLSREESLSSKAIIL
QIDNKSQQVSASALRHSLQDRLSKGATGRGRDEIYLKLRTSTAPPLKLIDLPGLDQRIVD
DAMIGEHAQHNDAILLVIVPASQASEISSCRALKTAKEYDPDSTRTVGIISKIDQAAENP
KALAAVQALLSNQGPPKTTDIPWVALIGQSVSIASAQSGGSENSLETAWRAETESLKSIL
TGAPQNKLGRIALVDTLASQIRSRMKLRLPNILSGLQGKSQVVQDELARLGEQLVSSVEG
TRAIALELCREFEDKFLLHLAGGEGSGWKVVASFEGNFPNRIKQLPLDRYFDLNNVKRIV
LEADGYQPYLISPEKGLRSLIKIVLELAKDPARLCVDEVHRVLVDIVSASANATPGLGRY
PPFKREVVAIASAALDGFKNEAKKMVVALVDMERAFVPPQHFIRLVQRRMERQRREDELK
GRSSKKGQDAEQSLLNRASSPQPDGSSTGGSLKSLKDKFLPQDKDKDKETPEVSGLKTAG
PEGEITAGYLMKKSAKTNGWSRRWFVLNEKTGKLGYTKKQEERNFRGTVTLEECSIEEIS
DDEGEKSKSSKDKKSNGPDSKGPGLVFKITCRVPYKTVLKAHNALILKAESMVDKNEWIN
KLQKVIQARGGQVGGASMRQSLSEGSLDKMVRKPVDPEEELRWMSQEVRGYVEAVLNSLA
ANVPKAVVLCQVEKSKEDMLNQLYSSISAIGNERIESLIQEDQNVKRKRDRYQKQSSLLS
KLTRQLSIHDNRAAAASSWSDSGTESSPRTNGGSAGEDWMNAFNAAASGPDSLKRYGSGG
HSRRYSDPAQNGEDDSSGSGGSNRRTTPNRLPPAPPQSGGSSYRY
Download sequence
Identical sequences M4DN14
Bra017901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]