SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra018449 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra018449
Domain Number 1 Region: 37-314
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.99e-33
Family G proteins 0.00083
Further Details:      
 
Domain Number 2 Region: 575-698
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-21
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra018449
Sequence length 913
Sequence
MEAIDELSQLSDSMKQAASLLADEDPDETSSSSRRPATFLNVVALGNVGAGKSAVLNSLI
GHAILPTGENGATRAPIIVDLSRESSLSSKAIILQIDNKSQQVSATALRHNLQDRLGKAA
PGKNRDEIYLKLRTSTAPPLKLVDLPGLDQRIVDDSMIAEYAQHNDAILLVIIPASQASE
ISSSRALKIAKEHDPESTRTVGIIGKIDQAEGNAKALAAVQALLSNQGPPKTTDIPWVAL
IGQSVSIASAAQSGSGENSLETAWRAESESLNKTLTGAPQSKLGRNALVETLASQIRSRM
KLRLPNILSGLQGKSQMVQNELARLGEQLVDSAEGTRAIALELCREFEEKFLLHLAGGEG
SGWKVVASFEGNFPNRIKQLPLDRHFDLNNVKRVVLEADGYQPYLISPEKGLRSLIKIVL
EMAKDPARLCVDEVHRVLVDIVSASANATPGLGRYPPFKREVVAIASAALDGFKNEAKKM
VVALVDMERAFVPPQHFIRLVQRRMERQRREDELKGRSSKKGQDAEQSLLSRASSPQPDG
PIAGGSMKSMKDKPSPQDKETREVSGLKTAGPEGEITAGYLMKKSAKTNGWSRRWFVLNE
KTGKLGYTKKQEERNFRGTITLEECTIEEIPEEEVEKSKSSKDKKANGPDSKGPGLVFKI
TCKVPYKTVLKAHNALVLKAESVVDKNEWINKLQKVIQARGGQVGNVSMRQSFSDGSLDK
MVRKPADPEEELRWMSQEVRGYVEAVLNSLAANAVVLCQVEKSKEDMLNQLYSSISAIGN
ERIESLIQEDQNVKRRRERYQKQSSLLSTLTRQLSIHDNRAAAASSWSDNGATESSPRTS
GGSSGDDWMNAFNSAANGASDSLSRYGSGGHSRRYSDPAQNGDASSSSSGSNRRSTPNRL
PPAPPQSGSSYRY
Download sequence
Identical sequences M4DPK8
Bra018449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]