SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra018854 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra018854
Domain Number 1 Region: 170-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-26
Family B3 DNA binding domain 0.00025
Further Details:      
 
Domain Number 2 Region: 51-109
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000000049
Family GCC-box binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra018854
Sequence length 340
Sequence
MFLVSSAIPMDVAKSETLNTNDSYLPVKKRMRLNEPPTTDKALVSASDKTKYKGVVQHQN
GHWGAQIYVDHKRIWLGTFKSAAEAAMSYDSASIKLRAFDANSQRNFPWSDLTVHEPVFQ
KGYTTEAVLNMIKDGSYQREFKEFLKNRSQIASKQNRRDEESNKCFSCTQLFQKELTASD
VGKLNRLVIPKKYAVKYLPFISEREEGEIVEDVEVVFYDREMRPWKFRYCYWTSSQSFVF
TRGWIGFVKEKRLKEKDLITFYTCDVPTLEGQSKKFLMIDVRYFSDNNSAVTDEEVNKTV
HNNSFDDVMKPEINSKLGGEEEAKPEENKGGFMLFGVRIQ
Download sequence
Identical sequences M4DQR1
XP_009147833.2.100322 Bra018854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]