SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra018966 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra018966
Domain Number 1 Region: 255-374
Classification Level Classification E-value
Superfamily PH domain-like 5.38e-30
Family Ran-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra018966
Sequence length 397
Sequence
MGDSESAQPPSKKRGALKQLSRENPDDDEDVSADFESGTFKKASDEVLASRRIVRIKRKE
PSAAPPAATTNPFAGIQLLPTTTAPASATVVESKLTPAEAVVEDNQKETDNDEDGDEVES
KKVDDVKESAEEETKDENQCGKTSDDQTTHEDVDKTVQGTDQTEDLVQKESGGDKEGDEA
DKNGDNTGSLSSFQQHSSIKNAFTGLATTDSSGPKFSFGDASGSPFGFGLPSSNSPSLFG
ASLTKKSEGSSGFPPKQEVSVETGEENEEAAFSADSIMFEYLDGGWRERGKGEVKVNVSS
NGGKARLVMRAKGNYRLILNASLYPEMKLASMDKKGITFACVNSEGRDGLSTFALKFKDP
TIVEEFRVAVDKHKGSKPVETAPALKTPENSPTATDA
Download sequence
Identical sequences M4DR23
XP_009147687.1.100322 XP_018507999.1.100322 Bra018966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]