SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra019258 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra019258
Domain Number 1 Region: 14-65,119-234
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000077
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Weak hits

Sequence:  Bra019258
Domain Number - Region: 84-116
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0235
Family Mitotic arrest deficient-like 1, Mad1 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra019258
Sequence length 255
Sequence
MDNGTPKKLNILPDHFTVPNQTTEASQEDSPSSPSSSHPKEDNISSRSHSQSQSSTRRKL
KRAAHMLNLFSLRRLPWVSDGQDKVELSAAELESLRSELSELEERESYLKAQLEHVDEVL
RSARLSGYLFIRSRWEALPGEPPPLDDAEVDDWLPRFVVLQGPCLFFYLLSTDLSPQDST
LLADIVEVGSLPSYTREFDETHHCFYILTRQGLRFECSSTSKTQVDSWLSVLRHDCRFVP
EERLPDGSSETAGVD
Download sequence
Identical sequences M4DRW5
Bra019258 XP_009137404.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]