SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra019814 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra019814
Domain Number 1 Region: 422-808
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.18e-109
Family Oxysterol-binding protein 0.00067
Further Details:      
 
Domain Number 2 Region: 87-116,165-223
Classification Level Classification E-value
Superfamily PH domain-like 2.37e-16
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra019814
Sequence length 819
Sequence
MNPLCCIAPVSIDDRTNPVIAKPASNHQLGLLPSNHASKPSFSTQASWISQDQLERLSSE
DVNLEGKDSTSNGGFFFGNGSVGAGVAGIMYKWTHYGKGWRARWFELEDGVLSYYKIHGP
DKIVMNPAREKGVRVIGEESVRYIRKASFGGSSNKLGAGAGAGAASRPCKPFGEVHLKVS
SIRASKSDDKRLTIFTGTKTLHLRCVSRENRATWVEALQVAKDLFPRVPSGDILPCEDAV
VSTEKLRERLLQEGIGENLVKDCETIMLSEVSNLQNRLKVLTQKHLILLDTLRQLETEKI
ELETTVVDETKEHDSCCGQGRRFSDFYSVVSEVSASDSEADNESHDGADVESDEDDVPFF
DTNDILSADALRSASYRSREAEGNGSIYDKDSFFSDRLQAPVRIPQYPYVRRRDNLPEPK
EKEKPVGLWSIIKENIGKDLSGVCLPVYFNEPLSSLQKCFEDLEYSYLIDRALEWGKQGN
ELMRLLNIAAFAVSGYASTEGRQCKPFNPLLGETYEADYPDKGLRFFSEKASQPTHLSPL
LLQEFHHPMIVACHCEGQGWNFWGDSNIKGKFWGRSIQLDPVGVLTLTFDDGETYQWSKV
TTSIYNIILGKLYCDHYGTMRIKGGGNYSCRLKFKEQSVIDRNPRQVHGFVQDNRTGEKV
AILIGKWDEAMYYVLGDPTTKPKGYDPMTEAVLLWERDKSPTKTRYNLSPFAISLNEITP
GMMDKLPPTDSRLRPDQRHLENGEYEAANAEKLRLEQLQRQARRLQEKGWKPRWFEKDEE
GNYRYVGGYWEAREKKDWDKITDIFKKQQQQRNSVSSSS
Download sequence
Identical sequences M4DTH1
Bra019814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]