SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra020844 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra020844
Domain Number 1 Region: 340-715
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.22e-113
Family Oxysterol-binding protein 0.00078
Further Details:      
 
Domain Number 2 Region: 59-89,125-189
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000143
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra020844
Sequence length 723
Sequence
MRVKELHPLCCITLESPHGIDDNNRPPVTNFTRSRSLPATSLAGGSNRRKVTSVGSESVA
GILHKWTNFGKGWRSRWFLLRNGILSYSKIRRPENLNLLSSSEDVRLIGDVSAGRLSRMD
SSSGRRKPKKTAGIVHLKVLDLILDFQKVSSFRESKSEDRKFYIFTATKTLHLRTDSISD
RAAWLRALASTKCIFPLRSLNGDFSFTSPKDLFISTERLKKRFHEEGINDNLVKECEQIM
LSEFSEMHEQVKLLHEERTNLFDALRQLETANLEAEASGNDDNGYQLTKHAFSSLGRGKY
SDEPSFHDTKEYFNEPNVGSGSNGYTDIKRRTKLPDPAEKEKGVSLWSMIKDNVGKDLTR
VCLPVYFNEPISSLQKCFEDLEYSYLLDRAYEHGKSGNGLLRALNVAAFAVSGYASTEGR
HCKPFNPLLGETYEADFPEKGIRFFSEKVSHHPTVIACHCEGKGWKFWGDTNLKSKFWGR
SIQVEPVGVLTLEFDDGEVFQWSKVTSTIYNIILGKLYCDHHGVMQIRGNRQYSCTLKFK
EQSILERNPHQVNGYVEDVSAKKAATVFGKWDDSLYYVAGDGVSKTKVSDPASNALLLWR
RTKPPPNVTRYNLTSFAITMNELTPGLEEMLPPTDSRLRPDQRHLENGEYEKANLEKQRL
ERRQRMSRQLQESGWRPRWFEKQGESETFKYTGGYWEARGRRTWYDCPDIFGEFTEEQLA
DSA
Download sequence
Identical sequences M4DWF0
Bra020844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]