SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra021067 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra021067
Domain Number 1 Region: 795-909
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000155
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra021067
Sequence length 4196
Sequence
MLEDQVAYLLQRYLGNYVRGLSKEALKISVWQGDVELKNMQLKPEALNALKLPVKVKAGF
LGSVKLKVPWSRLGQEPVVVYLDRIFLLAEPATDVEGCSEDSIQEKKRKLILEMETKLVE
RARRLHTEMNKSWVGSLVDTVMGNLKLSISNIHIRYEDLESNPGHPFSAGFTLEKLLAVT
VDENGKETFITGGTLASIQKSVELDRLAFYLDSDMSPWYIDKPWEDLLPSEWDQIFRYGT
KDGKPAEDLTRKHFYILQPVSGNAKYIKSQANGSSNTDQPLQKAYVNLDDVTLCLSKGGY
RDVMKLADNFSAFNQRLKYAHYRPSVSVKSDARSWWNYAFRVVSEQIKIASGRMSWEHVL
KYTSLRKRYITRYASLLKSDVSKTVVDDDEEIKALDRGLDTEVILQWRMLAHKFVERSVQ
AENYSKAQQAKSSWWPFGGKSQVSEGEGESVQFTDEDWERLNKVIGYKEGDEQSIINNAK
PDALHTFLEVHMRRNASKLYDGDKECLAELSCEDLNCSIKLFPETKIADIKLGRYRLSSP
NGPLAESAPASHSVLASFCYKPFDAKVDWSLVAKASPCYMTYLKDSIDGIVNFFESSTAV
SQTIALETAAAVQSTIDEVRRTAQQGMNRALKDHARFLLDLDIAAPKITIPTEFRPDNHR
STKLLLDLGNLVIRSQDDYKRELSEEMDMYLQFDLVLSDVSALLVDGDYSWKQLSSKKSS
GKESSVTFLPVIDKCGVLLKLQQIRRPNPSYPSTRLAVRLPSLGFHFSPARYHRLMQVAQ
IFQTKDDEGSHILRPWEEADFEGWLSLLSWKGREATWQRRYLCLVGPFIYVLESPNSKSY
KQYTSLRGKHIYKVPVELAGGVEHVLSIRNASRINEKVMEDVNALILMFDSEESRKTWHS
RLQSAVYRASGSAPIAGLSDTSSDSEESETEHKEDIWDLSKLESLYVTGVLDELKICFSY
GQQHDASFMAVLLARESKLFEFRAIGGKVEVSMRGSDMFIGTVLKSLEIEDLVSRSGSNE
SCYLARSFIQSSVVLPSFKDAEIKNPEGNDLSSSEGEEKFYEAPEILVDSVDYTSLRTPS
FSRMDGLLPVDNRNITMPSSERIESLDSFVKAQIVIYHQTSPQYNNIDNQVTVSLATLSF
YCRRPTILAILEFVNAINVEDPSCESFEDSSPVAGEQSSPKRNGFEDSRDAAVKGLLGKG
KSRIIFNLALNMARAQIFLMNENGTKFATLSQDNLLTDIKVFPNSFSITASLGNLRISDD
SLPDNHMYFWICDMRDPGGTSFVELAFTSFSVIDEDHEGFDYCLSGQLSEVRIVYLNRFI
QEVAEYFMGLVPSDSKGVVKMKDQITDSEKWFTTSEIEGSPALKLDLSLKKPIIVMPRHT
ESPDYLKLDVVHITVNNTFQWFAGDKNELNAVHMETMKVMVMDINLNVGSGAEIGESIIQ
DVNGVSVTINRSLRDLLHQIPSIEVSVEIDELRAALSNREYQILTECAQSNISEIPHTVP
PLSGDIVASSRNLPETLTSEDPNAAQTEKSDAWISMKVSVVINLVELCLYAGTARDAPLA
AVQISGGWLLYKSNTHDEGFLTATLKGFSVIDNREGTEKEFRLAVGRPADLDFGDSHSLT
DGDQRLTHSRVTNGSDVRPLPSMLTLDAQFGQSSTFVSVCIQRPQLLVALDFLLAVVEFF
VPTIGSVLSSEEDKNLNMVDAVIMDQSIYKQQTAEAFLSPLGPLIVEDEKFDDFVYDGNG
GTLYLKDRHGGILSSPSTEPVIYVGSGKKLHFRNVIFKNGQFLDSCISLGAYSSYSVSRE
EGVVLEEYHKVPKQDSESKEDPVSQSPSITTEKSTEMIIEFQAIGPELTFYNTSKDVVKT
PLLSNKLLHAQLDAYGRVIIKNDEIEMSAHTLGLTMESNGVKILEPFDTSVKYSSVSGTT
NIELSVSNIFMNFSFSILRLFIAVEEDILSFLRMTSRKMTVVCTEFDKVGIIRNQKYAFW
RPHPPPGFASLGDYLTPLDKPPTKGVLVVNTNLMRVKRPLSFRLIWSPLASNGLGDTSTD
DKDERDNLCSIWFPEAPKGYVALSCVVSSGCTPPPLASVFCILASSVSPCSLRDCVAISS
TDISQSSLAFWRVDNSVGSFLPADPSSLSLSGRPYELRHILFGSTGVLPKESSYVDVRTT
DNIQPIQPQSQPLNSVRSGQRFEAVASFQLIWWNRGSGSQKKVSIWRPIITEGMAYFGDI
AVSGYEPPNSCVVLRDDGEQDILKAAVDFQLVGRVKKHRGVESISFWMPQAPPGFVSLGC
VASKGSAKPYELTKLKCARSDMVAGDRFAEDSLWDTSDVWQRVEPFSIWGIGNELKTFIV
RSGLKKPPRRFALKLADQDLPGGIDNMVIRAEIGTFSAALFDDYGGLMVPLVNVSLSNIC
FGLLGKTNYTKSTINFSLAARSYNDKYEAWEPLIEPADGFLRYQFNPRSFGAVSELRLTS
TTDLNVNFSVSNANTIIQAYSSWNNLSNVHEYHKERGAFPLVDNGKSVIEVHQKKTYFII
PQNKLGQDIYIRPTEIKGFKDIVKMPSGDMRPVKVPVLTNMLDSHLRGELCSNPRIMVTV
IVVDAQLPRISGLSSHQYTGVIRLSPKQTSPTEPVLRQQCARTCGSVSNMFSSELEVVDW
SEIFFFKIDSLDDYLLELIVSDVGNGAPVGAFSAPLKQVARYMKDNQYEHNYANDLVWLD
LSTMSMNQGDQRKNCGKIRCAVLLPAKSKMVEQGKSSSEKKSGFIQVSPSIEGPWTTVRL
NYASPAACWRLGNDVVASEVSMEDGNRYVNVRSLVSVENNTEYLLDLCLEAKVHSFPNIS
IGLLKPGDILPVPLSGLTQSASYVLKLKCVMTDGSEYSWSSVVSRPEEPEVACESESEIC
ISSLTESEHLLCCTQISSTSPGHNKIYWFCLKTQATEIAKDIRSDPIQDWTLVVKSPFSI
ANYLPFGAEYSVLEKQDNGDLIRHSQSREFIGSGETVKVHTVDIRKPLYFSLLPQRVWLP
MREAVLVSHPNGVPAKTIDLRSSATGRVAQITLEQTYDDQQKVLTKMIRIYAPFWFSIAR
CPSLTLRLLDLPGNKKTKKFGLPFRNKKNDEVVREITEEDIYEGHTIASTLNFKHMGMSV
SISQFGNQQHGPAKDLSALGDMDGSLDVDAYDPDGKCMRLFLSTKPCGYQSVPTKIISVR
PFMTFTNRIGEDIYIKLNSDDEPKVLNAYDSRVSFVFQPSGRDELQVRLRETEWSFPVQV
AREDTIVLVLRCQNGARRFLKAEIRGFEEGSRFIVVFRLGPSNGPMRVENRTAVKRISVR
QSGFGEDSWVLLEPLTTVNFAWEDPYGQKFLDAKVENDHRSGVFRLDMENGVVDSELCRD
LEVNFHVKEIGDIKIARFTDDDSTSQSPHEIISLSSVGNNRYSTRQTPSEQKTTTLEFII
EMGLVGISLVDHVPKELSYFYLEKVFVSYSTGYDEGRTSRFKVILGNLQIDNQLPLTLMP
VLLAPDNTGDSHQPVLKMTITMCNEETDGIQVYPYVYVRVTDNTWRVNIHEPIIWASADF
CNKLQMDRLPKSTSVAQVDPEIHINLIDVSEVRLKVSLETAPAQRPHGILGVWSPILSAV
GNAFKIQVHLRRVMHRDRFIRKSSILPAIGNRIWRDLIHNPLHLIFSVDVLGMTSSTLAS
LSRGFAALSTDGQFLHLRERQVWSRRITGVGDAFVQGTEALAQGVAFGVSGVVTKPVESA
RQNGILGFAHGVGRAFLGFFVQPMSGALDFFSLTVDGIGASCTRCLEVLSNRTALERIRN
PRAVHADGILREYDEKEATGQMLLHLAEASRHFGCTEIFREPSKFALSDCYEEHFLVPYK
RIVIVTNKRVVLLQCSDLDKMDKKPSKIMWDVPWEELMALELAKAGGQRPSHLILHLKTF
QKSESFAQVIKCSVSEESDVLEPQAVRICSAVRKMWKAYQSNMKNHVLKVPSSQRHVYFA
WNEADGRDSKSYSNKAIIKSRDLSSSSSSVSDDRKFVKHSINFSKIWSSERESKGRCTLC
KKQVSEDGGVCTIWRPSCPEGFVSVGDVAHVGSHPPNVAAVYNNTEGVFALPVGYDLVWR
NCLDDYVSPVSIWHPRAPEGFVSPGCVAVASFKEPEPNTVYCMPTSLAEQTEFEEQKVWS
SPDSYPWACHIYQVRSDALHFMALRQTKEESDWRAIRVRDDYRSMESESARNLRIE
Download sequence
Identical sequences M4DX21
Bra021067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]