SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra023676 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra023676
Domain Number 1 Region: 59-151,183-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.15e-20
Family alpha-D-mannose-specific plant lectins 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra023676
Sequence length 388
Sequence
MFLGSVSAFSPLKTDTLKPGQQLRDWEQLISSGGVFTLGFFTPTESSTFLLGSAGVRYIG
IWYQYGPINPVWVGNPTESVSDSSGSLSIDTNGNLKITRANASPIMVNQHLSLAGNVSAT
LLDSGNFVIRDMGRGGVPGRVLWQSFDHPTSMLLPGMKIGFNLKTKKEISVTSWTSNQVP
ASGAFRLGLDPSGAKQLLVWRHGEIYWSSGVLTNNGSSQLTLELSREYLDYEFKFGSDKY
MKYFSYSIKKTNGSVYSNWLLDNLGQITVTNVLRSNTSNRWISESSQPCTTDLKNSSAVC
ITEKPTACRKGSEYFEPRRGYMTGSGYYGDSLSFGLSDCHGSCWRNCSCIAFQSFSDGQC
QYWGKGSKFFPYDSFTFEQKIYVLDSVK
Download sequence
Identical sequences M4E4H3
Bra023676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]