SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra025946 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra025946
Domain Number 1 Region: 102-202
Classification Level Classification E-value
Superfamily PH domain-like 0.00000758
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra025946
Sequence length 779
Sequence
MFSFTSFVFLSGFFLGIVAVLGAEAAGLMYLLNRLNRKSETRVDSKPGSDQSTKEISNSR
ESNKQGTIWVLELDEGLKNLWKEKLPTEHKRKRAFLEIHPIRKFARIKDHKLILSESDGT
MTTVSLKCCSVEAVSGSDLPTRKWAKRFPIKVESKSSSDVYKGNKVFYIYLETSWEKESW
CKALRLAACENPERFVWYSTKLQQDFRSYVTSLNAAYPSFMKPSLGFSFETLDKGNRTDG
SSSKVRLFLRRFSRKRSNREDSRTSVRSYQDSQNGRSVTGKNMGDDVRDEADPPVFSRSV
SHTSHFSGVSDGDSEEKFEMDEGTLAWNLLISRLFFDLMRKTGVKDSMQARIQRMLSNMR
TPSYIGELICSDVDLGNLPPHIHGTRVLPMEMNGVWAFEVDIEYSGEPVIDVETRVNIRE
VDLQKGINDARPQPSSAGEVSSNGVKDFDKQLVVIPVDAAEVKNDESNGSKGTKASPNGV
SRWKSILKNIAEQVSQVPISLSIRVSSLRGTLRVHMKPPPSDQLWFGFTSMPDIQFDLAS
SVGDHKITNSHVAMFLINRFKTAIREAVVLPNCESLTIPWMIAEKDDWVQRKAAPFMWLN
QESDHQATEGRSKSDKPPTSSSCVQSEQMQKTANATQKPVISEAETVSSSSCAQSEQVHE
AANAVQKANTEAEVMSTAVSSSSRPETVESDRSLEELKTPLLLPSSSEKQETNSRGSTFV
QSPSWSVVSSEDDDSRGKKLGRRARMLSLGKKMGEKLDEKRRHMEEKSRQIVDKMRGPS
Download sequence
Identical sequences M4EAY7
Bra025946 XP_009149234.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]