SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra027089 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra027089
Domain Number 1 Region: 1274-1585
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.17e-78
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 483-776
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-75
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 60-152,184-213
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.67e-26
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 
Domain Number 4 Region: 843-935,967-996
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-22
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra027089
Sequence length 1602
Sequence
MCTRLLLCGHAYYIQSNSLNKEDAHEAINSSSPLSIRQTLSSPGGFYELGFFSPNNTGNQ
YIGIWFKKIVPRVIVWVANRDKPVTSSAANLTISRNGSLILVDEKQAVIWSTGEASFPSS
RSHAELLDTGNLVLIDDVSRTTIWESFENLGNTMLPQSTLMYDLSHGKKRELTSWKSYSD
PSLGNFSLEITPQVPLQGLIRRGSVPYWRTGPWAKTRFTGFPQFDESYVSPFSVVQDLAT
GTGSFSYSTLRNFNLSYLTLTPEGNMEIYWDQGQKWMHHLTEPEHSCDIYGTCGPFGLCV
RSSTPRCICLKGFVPKKDVEWRKGNWTSGCVRRAQLSCQAKSSTKTQGRDTDIFYRMTNV
KTPDLHQFASFLDADMCYQGCLGNCSCTAFAYISGIGCLVWNGKLVDTVQFMSNGETISI
RLASSELAGSHRTKIIVATTACLSIFAILVFTAFMFWRYRAKQKEPTHVGINTLQNAWKN
DFEPQDISGVNFFEMHTIRTATDNFSSSNKLGQGGFGPVYKGKLLDGKEIAAKRLSSSSD
QGTGEFLNEIRLISKLQHRNLVRLLGYCIEGEEKLLIYEFMVNKSLDIFLFDSTLKLEID
WAKRFEIIQGIARGLLYLHRDSRLRVIHRDLKVSNILLDEKMNPKISDFGLARMFQGTQY
QDNTRRVVGTLGYMSPEYAWAGLFSEKSDIYSLGVLMLEIISGKKISRFSFGDGSKGLLA
YAWESWCETGGADLLDQDLTDSCNIYEVARCVQIGLLCVQHEASDRPNTLQVLSMITSTT
ELPTPKQPIFAAQTLNDVFTSEFSSYGYAAITRASPLSIGQTLSSPDGSYEFGFFSPNNS
RNQYVGVWFKNITPQVVVWVGNRDKPVTKTPANLTLSTNGSLVLLEGEEQDLVWSIGETF
SSNELRGELLDNGNFVLVDAVSGRILWQSFEHLGDTMLPQSSVMYNVPNNNKRVLSSWKS
PTDPSSGEFIAELTTQLPPQGFIMRGTIPYWRGGPWARERFTGTPEMDDSHVSQFSVSQD
ASAGTGFLTYSLQRNSNLSYTTLTPEGSLKIRWHDGSGWVTDFEAPVSSCDVYNTCGPYG
LCVRSNPPKCECLKGFIPRSDEEWNRRNWTGGCVRRTDLSCRVNSSVTTTTQGNGADVFD
VVANVKPPDFYEYLSLINAEECSQRCRGNCSCMAFSFVDQIGCLVWYRELVDVMQFSAGG
EVLSIRLASSELGGSNRTKIIVASAVSVCVFMIMVLASYWFWRRRHKAKQNDSTPTTMET
SEDAWEEELKQQDVYFFEMQTILAITDNFSIEKKLGQGGFGPVYKGKLQDGKEIAIKRLS
SSSGQGKQEFMNEIVLISKLQHRNLVRLMGCCIEGEEKLLIYEFLVNKSLNTFIFDSTKK
LELDWPKRFEIIQGIACGLLYLHRDSCLRVVHRDLKVSNILLDEEMNPKISDFGLARMFQ
GTQHQANTRRVVGTLGYMSPEYAWTGMFSEKSDIYAFGVLLLEIITGKRISSFTIGEEGK
SLLEYTWDCWRESGGADLLDQDISSSGSDTEVARCVQIGLLCIQQQALDRPNIAQVMSML
TTEMDLPEPKQPVFALQIQESDSDSKTMYSVNEITQTDIFGR
Download sequence
Identical sequences M4EE78
Bra027089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]