SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra030387 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra030387
Domain Number 1 Region: 285-406
Classification Level Classification E-value
Superfamily PH domain-like 5.69e-30
Family Ran-binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra030387
Sequence length 428
Sequence
MGGDSENAHQPSKKRGALKQLSRENPDADDDDIGSAELESGTFKKASDEVLATRRIVKIK
RKEPSPAAASNPFAGIQLLPTAPASGTNAPLAESKVAPAEAVVEDNQKAVDAEDGDEVDS
KKVDVKEEESEKTKDKDVDDNQCGKTSEDQVTDAGVDQTVSGVSVAVEGADQTEDHVEKE
SGGDQTVIKEKKGEASVEAVKNGDDNNNNGSLSSFQQHSSSKNAFTGLAGTQSSGSSFSF
GVVSQDGSSGPLYGFGLANSYNTSSLFGASGPSIIKKSEGTGFPPKQEVSTETGEENEKV
AFSADSIMFEYLDGGWRERGKGEVKVNVSSNGGKARLVMRAKGNYRLILNASLYPEMKLA
SMDKKGITFACVNSEGREGLSTFALKFKDPTIVEEFRVAVDKHKESKPVETAPPLKTPEN
SPTATDAA
Download sequence
Identical sequences M4ENL7
XP_009144846.1.100322 XP_009144847.1.100322 Bra030387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]