SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bra030458 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra030458
Domain Number 1 Region: 141-238
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-28
Family B3 DNA binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 12-71
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000333
Family GCC-box binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra030458
Sequence length 316
Sequence
MKPTVSPTATTKYKGVVQQQNGHWGAQIYADHKRIWLGTFKSAAEAAAAYDSASIKLRSF
DANSHRNFPWSEITIHEPDFQKSHTTEAVLNMIRESSYQQKFSDYLIVRSQMVAIANINI
VGSKQRRGGGEESTKCFSCTELFHKELTPSDVGKLNRLVIPKKHAVKHLPFISERDEGET
GGAVEDVEVVFYDRAMRQWKFRYCYWKSSQSFVFTRGWNGFVKEKNLKEKDVIVFYTCDV
PSNFKTLEGQSNKFLMIDVDYFTDKGSVEPKEVNEMVHNVSEREMKTENFFGTKVEEETK
SEVSKGGFMLFGVRIQ
Download sequence
Identical sequences M4ENT8
Bra030458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]