SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra031707 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra031707
Domain Number 1 Region: 36-312
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-31
Family G proteins 0.00082
Further Details:      
 
Domain Number 2 Region: 573-696
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-20
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra031707
Sequence length 915
Sequence
MDAIDELSQLSDSMKQAASLLADEDPDETSSSKRPATFLNVVALGNVGAGKSAALNSLIG
HPILPTGENGATRAPIIIDLSRDASLSSKAIILQIDNKNQQVSASALRHSLQDRLGKGAS
GKNRDEIYLKLRTSTAPPLKLVDMPGLDQRIVDDSMIAQYAQHNDAILLVIVPASQASEI
LSSRALKIAKEYDPESTRTVGIIGKIDQAAENPKALAAVQALLSNQGPPKTTDIPWVALI
GQSVAIASAQSGSGENSLETAWRAESESLKSILTGAPQSKLGRIALVDTLASQIRSRMKL
RLPNILSGLQGKSQTVQSELARLGEQLVDSAEGTRAIALELCREFEEKFLLHLVGGEGSG
WKVVESFEGNFPNRIKQLPLDRHFDLNNVKRVVLEADGYQPYLISPEKGLRSLIKIVLEL
AKDPARLCVDEVHRVLVDIVSASANATPGLGRYPPFKREVVAIASAALDGFKNEAKKMVV
ALVDMERAFVPPQHFIRLVQRRMERQRREEELKGRSSKKGQDAEQSLLSRASSPQPDGPI
AGGSMKSMKDKPSPQDKESPEVSGLKTAGPEGEITAGYLMKKSAKTNGWSRRWFVLNEKT
GKLGYTKKQEERNFRGTITLEECTIEELPEEEVEKSKSSKDKKANGPDSKGPGLVFKLTC
KVPYKTVLKAHNALVLKAESVVDKNEWINKLQKVIQARGGQVVNVSMRHSLSEGSIDKMA
RKPIDPEEELRWMSQEVRGYVEAVLNSLAANVPKAVVLCQVEKAKEDMLNQLYSSISAIG
NERIESLIQEDQNVKRRRERYQKQSSLLSKLTRQLSVHDNRAAAASSWSDNGAPESSPRT
SGGSSSGDDWRNAFNSAANGAPDSLSRYGSGGHSRRYSDPAQNGEAESPGSGSNRRTTPN
RLPPGPPQAGSSYKY
Download sequence
Identical sequences A0A078HAU9 M4ESC9
Bra031707 XP_009118259.1.100322 XP_013716080.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]