SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra031793 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra031793
Domain Number 1 Region: 70-164,192-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.07e-29
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  Bra031793
Domain Number - Region: 382-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000726
Family Pan module (APPLE domain) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra031793
Sequence length 445
Sequence
MKTSITLAIFLTLSIFSLTGAQAKVPIDEQFRVVNEGDYTDYSPIEYNADVRGFRPFNDN
FRLCFYNTTPNAYTLALRIGNRAQESTLRWVWEANRDSPVKEDATLTFGEDGNLVLAEAD
GRVVWQTNTANKNAVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKANGQNKL
VSRRSPSVNANGPYSLVMEAKKLVLYYTTNKTPKPIAYYEYEFFTKITQLQSMTFQAVED
SDTTWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFLRLESDGNVRVWSYSTSASSTAWDV
TYTAFTNADTDGNDECRLAEHCGEFGLCKKGQCNACPSDKGLLGWDEATCKTPSLTSCDP
KTFHYFKIEGADSFMTKYNGGSSTTEKACGDKCTRDCKCLGFFYNRKSSRCWLGYELKTL
TRTGDASLVAYVKAPNANKNSALAI
Download sequence
Identical sequences A0A078HDC2 M4ESL3
XP_009118161.1.100322 XP_013732204.1.73403 Bra031793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]