SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra033055 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra033055
Domain Number 1 Region: 206-417
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-62
Family SSRP1-like 0.0000166
Further Details:      
 
Domain Number 2 Region: 525-608
Classification Level Classification E-value
Superfamily HMG-box 9.16e-28
Family HMG-box 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra033055
Sequence length 623
Sequence
MTDVHSFNNISLSGRGGSNPGLLKINSGGIQWKKQGGGKAVEVDKSDIVGVSWMKVPRTN
QLGVKTKDGLYYKFIGFRDQDVASLTSFFQSAFGKTPEEKQLSVSGRNWGEVDLNGNNLT
FLVGGKQAFEVSLADVSQTQLQGKNDVLLEFHVDDTAGANEKDSLMEISFHIPNTNTQFV
GDETRPPAQVFHDNILKVADVGAGVEEAVVTFEGIAILTPRGRYNVELHLSFLRLQGQAN
DFKIQYSSVVRLFLLPKSNQPHTFVVISLDPPIRKGQTLYPHIVMQFETDSVVESELSIS
DDLMNTRFKDKLERSYKGLIHEVFTTVLRWLSGAKITKPGKFRSSQDGFAVKSSLKAEDG
IDYVEFERHAAGGANMHYFDLSIRLKTDHEHLFRNIQRNEYHNLYSFISSKGLKIMNLGG
AGTAEGVAAVLQDNDDDDAVDPHLERIRNQAADESDEEDEDFVGAEDDDGGSPTDDSGED
DDSDASDADGGEKEKSVKKEPKKEASSSKGLPLKKKALATEEGSSKKKTQKKKKDPNAPK
KAMSGFMYFSQMERDNIKKSNPGIGFGDIGKVLGDKWRQMSAEEKEPYEAKAQVDKKRYK
DEISDYKNPQPMLVDSGNDSDSN
Download sequence
Identical sequences M4EW71
Bra033055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]