SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra033128 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra033128
Domain Number 1 Region: 233-358
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-17
Family Ran-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra033128
Sequence length 361
Sequence
MRGLKRAAVSESFPEVNQSPFKNAKPVEGTLFGTTQHSSSSLDKQRAELARKHVRALNNQ
FVSWVQMQLKNHPDELWEDGMHDYISHASNILEKFKDVVNWVKQSKGKGDNVSPESTGAE
KKQVGEVENNDVKPASNNSLFALNTQPGIFSTNQSSNFSSSPFGLASNSQSGSFSSGQFG
LAKSNSQPSFSFSNNQNPFSSRVTPVSIPTKRDSPEDADGEDEEPQPSSPSVRKTEEKGV
TVVHEVKCKLYVKSNDPTDKGAWKDKGAGNLCIKCKEGVDKGTKESKPTILVRNDVGKLL
LNALLYTGIKTNAQKNALVAIFHSSEDSNENVTPRTFLIRTKTAEARDKLATAIQEYAPS
S
Download sequence
Identical sequences M4EWE4
Bra033128 XP_009128653.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]