SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra033348 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra033348
Domain Number 1 Region: 256-570
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.38e-105
Family Pectin methylesterase 0.000000058
Further Details:      
 
Domain Number 2 Region: 573-693
Classification Level Classification E-value
Superfamily At5g01610-like 1.31e-33
Family At5g01610-like 0.0016
Further Details:      
 
Domain Number 3 Region: 30-185
Classification Level Classification E-value
Superfamily Plant invertase/pectin methylesterase inhibitor 8.24e-22
Family Plant invertase/pectin methylesterase inhibitor 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra033348
Sequence length 700
Sequence
MESPLLFLITLLCFLQSLLVASHNLSKSSTICKTTPDPKYCKTVFPHSQGNVQQYGRFSI
RKSLSQSRKFIRTVDKYLKRNAHASPPAVTRALQDCRFLAGLTMDYLLTSFETVNETSTF
KTLSFPKADDVQTLLSAALTNEQTCLEGLTTAASSSATWTVRNGVALPLVNDTKLFSVSL
ALFTKGWVPKKKKRAGYPWAHPSSGTSTHTKPFRLFRNGALPLKMTERTKAVYESLSRRK
LTDGAGDGDDGSMVLISDIVTVIQDGTGNFTNITAAVGAAPNNTDGSGGFFLIYVTAGIY
EEYVSIAKNKRYVMMIGDGINQTVVTGNRSVVDGWTTFNSATFAVTAPNFVAVNITFQNT
AGPEKHQAVALRSGADFSIFYSCSFEAYQDTLYTHYLRQLYRECDVYGTVDFIFGNAAVV
FQNCNLYPRKPMPNQFNAITAQGRSDPNQNTGTSIQNCTIRPADDLVLSNYTVETYLGRP
WKNYSRTVIMESYIDGFVEPVGWREWNGDFALSTLYYAEYNNTGPGSNTTNRVTWPGYHV
INSTDAANFTVTGLFLEDDWIWKTGVPYTSGTNLTAYDVVQKYKLPRGILPEGVIDYDLN
PKTGFFKVYLNNTCRFPIEVYKVKYQPIVSGFIKNGRVSRLKGVSVKVLYFWLSIGEVTS
DGQELELSVGAASEEFSAHQFARSPQCGCGFYCRELKFSS
Download sequence
Identical sequences M4EX13
Bra033348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]